Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Immunology/Inflammation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse.html

Purity

98.0

Smiles

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (D33-C166) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Acid ceramidase (ASAH1) ELISA Kit
MBS7234638-01 48 Well

Porcine Acid ceramidase (ASAH1) ELISA Kit

Sign In for Pricing
View Details
Porcine Acid ceramidase (ASAH1) ELISA Kit
MBS7234638-02 96 Well

Porcine Acid ceramidase (ASAH1) ELISA Kit

Sign In for Pricing
View Details
Porcine Acid ceramidase (ASAH1) ELISA Kit
MBS7234638-03 5x 96 Well

Porcine Acid ceramidase (ASAH1) ELISA Kit

Sign In for Pricing
View Details
Porcine Acid ceramidase (ASAH1) ELISA Kit
MBS7234638-04 10x 96 Well

Porcine Acid ceramidase (ASAH1) ELISA Kit

Sign In for Pricing
View Details
Gbf1-set siRNA/shRNA/RNAi Lentivector (Mouse)
21351094 4x 500 ng

Gbf1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
3,5-Dimethylpyrazole-4-boronic Acid Hydrochloride
427501-01 25 mg

3,5-Dimethylpyrazole-4-boronic Acid Hydrochloride

Sign In for Pricing
View Details