Question 1

What is the catalog number for USP53?

Accepted Answer

The catalog number for USP53 is 405476.

Question 2

What sizes are available for USP53?

Accepted Answer

USP53 is available in the following size(s): 50 µL, 100 µL.

Question 3

How many pack sizes does USP53 come in?

Accepted Answer

USP53 is available in 2 different pack sizes.

Question 4

Is USP53 in stock?

Accepted Answer

USP53 is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What is the shelf life of this product?

Accepted Answer

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

Question 6

What expression system was used for this recombinant protein?

Accepted Answer

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Question 7

Can I return this product if I ordered the wrong one?

Accepted Answer

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

USP53

Product Specifications

Clonality

Available Sizes

Frequently Asked Questions

Explore Other Products

Human FGF 1 Protein

Human FGF 1 Protein

Human FGF 1 Protein

Recombinant Thermosipho melanesiensis Cobalamin synthase (cobS)

Recombinant Thermosipho melanesiensis Cobalamin synthase (cobS)

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN