Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF166 (NM_001171815) Human Tagged ORF Clone Lentiviral Particle
RC229603L4V 200 µL

RNF166 (NM_001171815) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AKR1D1 (NM_001190907) Human Tagged ORF Clone Lentiviral Particle
RC231133L3V 200 µL

AKR1D1 (NM_001190907) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FCGR2A AAV Vector (Rat) (CMV)
20386106 1 µg

FCGR2A AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Lentiviral human ZNF860 shRNA (UAS) - Lentiviral human ZNF860 shRNA (UAS, GFP) plasmid
GTR15092086 1 Vial

Lentiviral human ZNF860 shRNA (UAS) - Lentiviral human ZNF860 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (Azide free) (HRP)
MBS6271028-01 0.2 mL

ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (Azide free) (HRP)

Sign In for Pricing
View Details
ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (Azide free) (HRP)
MBS6271028-02 5x 0.2 mL

ACP5, NT (ACP5, Tartrate-resistant acid phosphatase type 5, Tartrate-resistant acid ATPase, Type 5 acid phosphatase) (Azide free) (HRP)

Sign In for Pricing
View Details