Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAC1, CT (TAC1, NKA, NKNA, TAC2, Protachykinin-1, PPT, Substance P, Neurokinin A, Neuromedin L, Substance K, Neuropeptide K, Neuropeptide gamma, C-terminal-flanking peptide) (MaxLight 405)
MBS6353198-01 0.1 mL

TAC1, CT (TAC1, NKA, NKNA, TAC2, Protachykinin-1, PPT, Substance P, Neurokinin A, Neuromedin L, Substance K, Neuropeptide K, Neuropeptide gamma, C-terminal-flanking peptide) (MaxLight 405)

Sign In for Pricing
View Details
TAC1, CT (TAC1, NKA, NKNA, TAC2, Protachykinin-1, PPT, Substance P, Neurokinin A, Neuromedin L, Substance K, Neuropeptide K, Neuropeptide gamma, C-terminal-flanking peptide) (MaxLight 405)
MBS6353198-02 5x 0.1 mL

TAC1, CT (TAC1, NKA, NKNA, TAC2, Protachykinin-1, PPT, Substance P, Neurokinin A, Neuromedin L, Substance K, Neuropeptide K, Neuropeptide gamma, C-terminal-flanking peptide) (MaxLight 405)

Sign In for Pricing
View Details
Rat Monoclonal Peripheral Node Addressin Antibody (MECA-79)
NB100-77673SS 0.1 mg

Rat Monoclonal Peripheral Node Addressin Antibody (MECA-79)

Sign In for Pricing
View Details
Human SLC25A42 Knockout A549 cell line
GTR15406425 1 Vial

Human SLC25A42 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Signal Transducer And Activator Of Transcription 5A (STAT5A)
SIPB875Hu02-01 10 µg

Recombinant Signal Transducer And Activator Of Transcription 5A (STAT5A)

Sign In for Pricing
View Details
Recombinant Signal Transducer And Activator Of Transcription 5A (STAT5A)
SIPB875Hu02-02 50 µg

Recombinant Signal Transducer And Activator Of Transcription 5A (STAT5A)

Sign In for Pricing
View Details