Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf40 Protein Vector (Human) (pPM-C-HA)
PV006895 500 ng

C8orf40 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-PGRMC1/MPR Antibody
MBS2401522-01 0.05 mL

Anti-PGRMC1/MPR Antibody

Sign In for Pricing
View Details
Anti-PGRMC1/MPR Antibody
MBS2401522-02 5x 0.05 mL

Anti-PGRMC1/MPR Antibody

Sign In for Pricing
View Details
TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)
134836-Biotin 100 µL

TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)

Sign In for Pricing
View Details
Anti-Ly-6G Antibody [RB6-8C5], Biotin-100ug
QAB77-B-100ug 100ug

Anti-Ly-6G Antibody [RB6-8C5], Biotin-100ug

Sign In for Pricing
View Details
Recombinant Escherichia coli Glycerol-3-phosphate acyltransferase (plsY)
MBS7026432-01 0.02 mg

Recombinant Escherichia coli Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details