Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle
RC206176L3V 200 µL

HIPK1 (NM_181358) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human CXCL12a, biotinylated
50185PB-2-1 2 µg

Recombinant Human CXCL12a, biotinylated

Sign In for Pricing
View Details
Rat Ndrg1 ELISA Kit
ELI-22197r 96 Tests

Rat Ndrg1 ELISA Kit

Sign In for Pricing
View Details
Iyd Mouse qPCR Template Standard (NM_027391)
MK201229 1 Kit

Iyd Mouse qPCR Template Standard (NM_027391)

Sign In for Pricing
View Details
JIP2 Colorimetric Cell-Based ELISA Kit
MBS9500828-01 1 Kit

JIP2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
JIP2 Colorimetric Cell-Based ELISA Kit
MBS9500828-02 5x 1 Kit

JIP2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details