Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PSMG1 shRNA (UAS) - Lentiviral human PSMG1 shRNA (UAS, GFP) plasmid
GTR15163678 1 Vial

Lentiviral human PSMG1 shRNA (UAS) - Lentiviral human PSMG1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Polysucrose 1000
HY-131960D 1 Each

Polysucrose 1000

Sign In for Pricing
View Details
Bovine Lactadherin ELISA Kit
OM625080 96 Strip Well

Bovine Lactadherin ELISA Kit

Sign In for Pricing
View Details
HBA1 Polyclonal Antibody
MBS9434020-01 0.05 mL

HBA1 Polyclonal Antibody

Sign In for Pricing
View Details
HBA1 Polyclonal Antibody
MBS9434020-02 0.1 mL

HBA1 Polyclonal Antibody

Sign In for Pricing
View Details
HBA1 Polyclonal Antibody
MBS9434020-03 5x 0.1 mL

HBA1 Polyclonal Antibody

Sign In for Pricing
View Details