Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMCR7L Recombinant Protein (Rat)
RP230087 100 µg

SMCR7L Recombinant Protein (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Rabif shRNA (UAS) - Lentiviral mouse Rabif shRNA (UAS, iRFP) (100)
GTR15240495 1 Vial

Lentiviral mouse Rabif shRNA (UAS) - Lentiviral mouse Rabif shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Laminin-5 (P3H9-2) : m-IgG1 BP-HRP Bundle
sc-531937 1 Kit

Laminin-5 (P3H9-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Olfactory receptor 5H1 Polyclonal Antibody
JOT-AP06509-01 50ul

Olfactory receptor 5H1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 5H1 Polyclonal Antibody
JOT-AP06509-02 100ul

Olfactory receptor 5H1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL17F/ IL-17F Protein, Untagged, E.coli-500ug
QP1479-500ug 500ug

Recombinant Mouse IL17F/ IL-17F Protein, Untagged, E.coli-500ug

Sign In for Pricing
View Details