Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp235 3'UTR Luciferase Stable Cell Line
TU223682 1.0 mL

Zfp235 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
pBlueScriptR-USP16 Plasmid
PVT17295 2 µg

pBlueScriptR-USP16 Plasmid

Sign In for Pricing
View Details
PMS1 (NM_001128143) Human Tagged Lenti ORF Clone
RC226240L4 10 µg

PMS1 (NM_001128143) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human C6ORF118 Protein Lysate
MBS138458-01 0.02 mg

Human C6ORF118 Protein Lysate

Sign In for Pricing
View Details
Human C6ORF118 Protein Lysate
MBS138458-02 5x 0.02 mg

Human C6ORF118 Protein Lysate

Sign In for Pricing
View Details
ZNF543, NT (ZNF543, Zinc finger protein 543) (Azide free) (HRP) discontinued
044271-HRP 200 µL

ZNF543, NT (ZNF543, Zinc finger protein 543) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details