Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD117 (KIT/982), CF488A conjugate, 0.1mg/mL
BNC880982-100 1x 100 µL

CD117 (KIT/982), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details