Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Retinoblastoma protein phosphoserine 780 Antibody
3114-1 25 µg

Anti-Retinoblastoma protein phosphoserine 780 Antibody

Sign In for Pricing
View Details
MRS2 Protein Vector (Human) (pPM-C-His)
PV026816 500 ng

MRS2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2) (Azide free) (HRP)
MBS6500473-01 0.2 mL

SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2) (Azide free) (HRP)

Sign In for Pricing
View Details
SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2) (Azide free) (HRP)
MBS6500473-02 5x 0.2 mL

SPHK2, CT (Sphingosine Kinase 2, SK 2, SPK 2) (Azide free) (HRP)

Sign In for Pricing
View Details
HighYield T7 AZDye594 RNA Labeling Kit (UTP-based)
JBS-RNT-101-AZ594 20 Reactions

HighYield T7 AZDye594 RNA Labeling Kit (UTP-based)

Sign In for Pricing
View Details
Rabbit anti-Laminin Receptor Antibody
MBS4512416-01 0.05 mL

Rabbit anti-Laminin Receptor Antibody

Sign In for Pricing
View Details