Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

HENMT1 (NM_001102592) Human Tagged Lenti ORF Clone
RC212823L4 10 µg

HENMT1 (NM_001102592) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Ache/Acetylcholinesterase ELISA Kit
E0018Mo 96 Tests

Mouse Ache/Acetylcholinesterase ELISA Kit

Sign In for Pricing
View Details
CDC26 (Anaphase-Promoting Complex Subunit CDC26, Cell Division Cycle 26 Homolog (S. Cerevisiae) )
477585 100 µL

CDC26 (Anaphase-Promoting Complex Subunit CDC26, Cell Division Cycle 26 Homolog (S. Cerevisiae) )

Sign In for Pricing
View Details
ARHGAP16P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV757445 1.0 µg DNA

ARHGAP16P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human APCS ELISA kit
OM641654 96 Tests

Human APCS ELISA kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit
abx154003-01 96 Tests

Mouse Fibroblast Growth Factor 18 (FGF18) ELISA Kit

Sign In for Pricing
View Details