Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP2 Mouse Monoclonal Antibody [Clone ID: LBI3D12]
AMM14387V 100 µL

SENP2 Mouse Monoclonal Antibody [Clone ID: LBI3D12]

Sign In for Pricing
View Details
Aipl1 3'UTR Luciferase Stable Cell Line
TU101595 1.0 mL

Aipl1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mycobacterium tuberculosis (M. tuberculosis) Antibody
abx415707 1 mL

Mycobacterium tuberculosis (M. tuberculosis) Antibody

Sign In for Pricing
View Details
P2rx5 ORF Vector (Rat) (pORF)
ORF073021 1.0 µg DNA

P2rx5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Lentiviral human UPF3B shRNA (UAS) - Lentiviral human UPF3B shRNA (UAS, GFP) plasmid
GTR15135166 1 Vial

Lentiviral human UPF3B shRNA (UAS) - Lentiviral human UPF3B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SRPX Polyclonal Antibody
MBS2524452-01 0.02 mL

SRPX Polyclonal Antibody

Sign In for Pricing
View Details