Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

KEAP1 Protein Vector (Human) (pPM-C-HA)
PV022323 500 ng

KEAP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Dip2a shRNA (UAS) - Lentiviral mouse Dip2a shRNA (UAS, RFP) (25)
GTR15281231 1 Vial

Lentiviral mouse Dip2a shRNA (UAS) - Lentiviral mouse Dip2a shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
(R)-Quizalofop-tefuryl
TRC-Q826105-10MG 10 mg

(R)-Quizalofop-tefuryl

Sign In for Pricing
View Details
SVOC Std Nitroquinoline-1-oxide 1000ug/mL in DCM - 1ML
RESVOC063 1 mL

SVOC Std Nitroquinoline-1-oxide 1000ug/mL in DCM - 1ML

Sign In for Pricing
View Details
Anti-Histone H3.1 (Phospho-Ser10)
Y011184 100 µg

Anti-Histone H3.1 (Phospho-Ser10)

Sign In for Pricing
View Details
Recombinant Human Fc receptor-like protein 1, His-SUMO, E.coli-50ug
QP7876-ec-50ug 50ug

Recombinant Human Fc receptor-like protein 1, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details