Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CART (1-39), Human, Rat

CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior[1].

Product Specifications

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Neuroscience-Neuromodulation

Field of Research

Neurological Disease

Assay Protocol

https://www.medchemexpress.com/cart-1-39-human-rat.html

Solubility

10 mM in DMSO

Smiles

[{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ]

Molecular Formula

C188H303N57O63

Molecular Weight

4369.76

References & Citations

[1]Dun SL, et, al. Expression and activity of cocaine- and amphetamine-regulated transcript peptide (1-39) in the rat. Regul Pept. 2007 Apr 5;140 (1-2) :47-54.

Shipping Conditions

Room temperature

Scientific Category

Peptides

Clinical Information

No Development Reported

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep ATPase (ATPase) ELISA Kit
YP-W79116-01 48 Tests

Sheep ATPase (ATPase) ELISA Kit

Sign In for Pricing
View Details
Sheep ATPase (ATPase) ELISA Kit
YP-W79116-02 96 Tests

Sheep ATPase (ATPase) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Inhibin alpha Antibody (INHA/4266) [Alexa Fluor 488]
NBP3-08780AF488 100 µL

Mouse Monoclonal Inhibin alpha Antibody (INHA/4266) [Alexa Fluor 488]

Sign In for Pricing
View Details
Lentiviral human WDR88 shRNA (UAS) - Lentiviral human WDR88 shRNA (UAS, iRFP) plasmid
GTR15136972 1 Vial

Lentiviral human WDR88 shRNA (UAS) - Lentiviral human WDR88 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PiggyBac-CMV-GLRA1-EF1a-Puro Plasmid
PVT41049 2 µg

PiggyBac-CMV-GLRA1-EF1a-Puro Plasmid

Sign In for Pricing
View Details
DCAF5 siRNA (Human)
CRH5814-01 15 nmol

DCAF5 siRNA (Human)

Sign In for Pricing
View Details