Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sclerostin (Sost)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Mouse Sost protein

Gene Name

Sost

UniProt

Q99P68

Expression Region

24-211aa

Organism

Mus musculus (Mouse)

Target Sequence

QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf87 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14012062 1.0 µg DNA

C17orf87 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PCMV-Twinstrep-HTR3D-mEGFP-FLAG-10xHis-mCherry Plasmid
PVT71532 2 µg

PCMV-Twinstrep-HTR3D-mEGFP-FLAG-10xHis-mCherry Plasmid

Sign In for Pricing
View Details
CNTN5 (NM_001243271) Human Tagged ORF Clone
RG233168 10 µg

CNTN5 (NM_001243271) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sheep Lipocalin 10 (LCN10) ELISA Kit
MBS9357242-01 48 Well

Sheep Lipocalin 10 (LCN10) ELISA Kit

Sign In for Pricing
View Details
Sheep Lipocalin 10 (LCN10) ELISA Kit
MBS9357242-02 96 Well

Sheep Lipocalin 10 (LCN10) ELISA Kit

Sign In for Pricing
View Details
Sheep Lipocalin 10 (LCN10) ELISA Kit
MBS9357242-03 5x 96 Well

Sheep Lipocalin 10 (LCN10) ELISA Kit

Sign In for Pricing
View Details