Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lithobates catesbeiana Saxiphilin , partial

Product Specifications

Product Name Alternative

Short name: SAX

Abbreviation

Recombinant Lithobates catesbeiana Saxiphilin protein, partial

UniProt

P31226

Expression Region

484-844aa

Organism

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Target Sequence

AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Tag

C-terminal 9xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe (3+) . It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Molecular Weight

41.7 kDa

References & Citations

"Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK2 Antibody
A52959-50UL 50 μL

PAK2 Antibody

Sign In for Pricing
View Details
Rabbit anti-DNAL4 Antibody
MBS4512208-01 0.05 mL

Rabbit anti-DNAL4 Antibody

Sign In for Pricing
View Details
Rabbit anti-DNAL4 Antibody
MBS4512208-02 0.1 mL

Rabbit anti-DNAL4 Antibody

Sign In for Pricing
View Details
Rabbit anti-DNAL4 Antibody
MBS4512208-03 5x 0.1 mL

Rabbit anti-DNAL4 Antibody

Sign In for Pricing
View Details
Cyfip2 sgRNA CRISPR Lentivector set (Mouse)
K4689701 3x 1.0 µg

Cyfip2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Guinea pig mannan binding lectin associated serine protease (MASP) ELISA Kit
NSL0061Gp 96 Tests

Guinea pig mannan binding lectin associated serine protease (MASP) ELISA Kit

Sign In for Pricing
View Details