Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lithobates catesbeiana Saxiphilin , partial

Product Specifications

Product Name Alternative

Short name: SAX

Abbreviation

Recombinant Lithobates catesbeiana Saxiphilin protein, partial

UniProt

P31226

Expression Region

484-844aa

Organism

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Target Sequence

AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Tag

C-terminal 9xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe (3+) . It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Molecular Weight

41.7 kDa

References & Citations

"Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGE 7.90- - Fire-proof safety cabinet 90 minutes under-bench 2 yellow doors boat equipped
792-PJBE each

RANGE 7.90- - Fire-proof safety cabinet 90 minutes under-bench 2 yellow doors boat equipped

Sign In for Pricing
View Details
Rabbit Polyclonal INSM1 Antibody [FITC]
NBP1-76307F 0.1 mL

Rabbit Polyclonal INSM1 Antibody [FITC]

Sign In for Pricing
View Details
HMGN2P23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV728252 1.0 µg DNA

HMGN2P23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human FcERI/ FCER1A Protein, His, Yeast-100ug
QP6026-ye-100ug 100ug

Recombinant Human FcERI/ FCER1A Protein, His, Yeast-100ug

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r185 shRNA (UAS) - Lentiviral mouse Vmn1r185 shRNA (UAS) plasmid
GTR15212995 1 Vial

Lentiviral mouse Vmn1r185 shRNA (UAS) - Lentiviral mouse Vmn1r185 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Toxoplasma gondii (FITC) discontinued
T8076-FITC 100 µL

Toxoplasma gondii (FITC) discontinued

Sign In for Pricing
View Details