Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI2 siRNA (Rat)
MBS8226219-01 15 nmol

TNNI2 siRNA (Rat)

Sign In for Pricing
View Details
TNNI2 siRNA (Rat)
MBS8226219-02 30 nmol

TNNI2 siRNA (Rat)

Sign In for Pricing
View Details
TNNI2 siRNA (Rat)
MBS8226219-03 5x 30 nmol

TNNI2 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)
MBS1006870-01 0.02 mg (E-Coli)

Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)

Sign In for Pricing
View Details
Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)
MBS1006870-02 0.1 mg (E-Coli)

Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)

Sign In for Pricing
View Details
Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)
MBS1006870-03 0.02 mg (Yeast)

Recombinant Brucella canis UPF0178 protein BCAN_A2024 (BCAN_A2024)

Sign In for Pricing
View Details