Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD168 Rabbit Monoclonal Antibody
TD-R23788 100 µL

CD168 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NARC1 Polyclonal Antibody Cy3 Conjugated
MBS9461663-01 0.1 mL

NARC1 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
NARC1 Polyclonal Antibody Cy3 Conjugated
MBS9461663-02 5x 0.1 mL

NARC1 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC29 Antibody [Alexa Fluor 647]
NBP3-05972AF647 0.1 mL

Rabbit Polyclonal LRRC29 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse monoclonal Histone Deacetylase 2/HDAC2 Antibody (C.15200201)
NBP2-59269 50 µg

Mouse monoclonal Histone Deacetylase 2/HDAC2 Antibody (C.15200201)

Sign In for Pricing
View Details
Human Calcitonin Gene-Related Peptide 2 (CALCB) Protein
abx691101 100 µg

Human Calcitonin Gene-Related Peptide 2 (CALCB) Protein

Sign In for Pricing
View Details