Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0876603 1.0 µg DNA

GNG2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
5β-PREGNAN-3α, 17, 21-TRIOL-11, 20-DIONE 3-ACETATE
505402 Inquire

5β-PREGNAN-3α, 17, 21-TRIOL-11, 20-DIONE 3-ACETATE

Sign In for Pricing
View Details
Ras-Related protein Rab-19 (RAB19) Rat ELISA Kit
G6520 96 Tests

Ras-Related protein Rab-19 (RAB19) Rat ELISA Kit

Sign In for Pricing
View Details
Adenosine Receptor A1 (ADORA1) Antibody (APC)
abx445201 100 µg

Adenosine Receptor A1 (ADORA1) Antibody (APC)

Sign In for Pricing
View Details
2-(((6-Oxo-2-propylheptyl)oxy)carbonyl)benzoic Acid-d4
TRC-O859992-25MG 25 mg

2-(((6-Oxo-2-propylheptyl)oxy)carbonyl)benzoic Acid-d4

Sign In for Pricing
View Details
EPPIN siRNA (Mouse)
CRM9444-01 15 nmol

EPPIN siRNA (Mouse)

Sign In for Pricing
View Details