Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Radixin (RDX) Human shRNA Plasmid Kit (Locus ID 5962)
TR309884 1 Kit

Radixin (RDX) Human shRNA Plasmid Kit (Locus ID 5962)

Sign In for Pricing
View Details
COPE Recombinant Mouse mAb
E47M60452 100 µL

COPE Recombinant Mouse mAb

Sign In for Pricing
View Details
Histofine Simple Stain MAX PO (R)
414142F 500 Tests

Histofine Simple Stain MAX PO (R)

Sign In for Pricing
View Details
2D Cryobox 81 Places for 2mL Tubes 2D - Light Blue
CRY1192-EA 1 Each

2D Cryobox 81 Places for 2mL Tubes 2D - Light Blue

Sign In for Pricing
View Details
Scn8a Mouse shRNA Lentiviral Particle (Locus ID 20273)
TL501981V 500 µL Each

Scn8a Mouse shRNA Lentiviral Particle (Locus ID 20273)

Sign In for Pricing
View Details
EMWX Protein Vector (Human) (pPB-N-His)
PV075530 500 ng

EMWX Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details