Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR56 (ADGRG1) (NM_001145772) Human Tagged ORF Clone Lentiviral Particle
RC226886L4V 200 µL

GPR56 (ADGRG1) (NM_001145772) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant BPI Antibody
RC-15437-01 50 μL

Recombinant BPI Antibody

Sign In for Pricing
View Details
Recombinant BPI Antibody
RC-15437-02 100 µL

Recombinant BPI Antibody

Sign In for Pricing
View Details
Recombinant BPI Antibody
RC-15437-03 1 mL

Recombinant BPI Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ptpn22 shRNA (UAS) - Lentiviral mouse Ptpn22 shRNA (UAS, GFP) plasmid
GTR15150394 1 Vial

Lentiviral mouse Ptpn22 shRNA (UAS) - Lentiviral mouse Ptpn22 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for shiga toxin (stx1) producing Escherichia coli, Standard
348952 1 Kit

Genesig Real-Time PCR detection kit for shiga toxin (stx1) producing Escherichia coli, Standard

Sign In for Pricing
View Details