Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Modified Sulfite Agar
LA5440 250 g

Modified Sulfite Agar

Sign In for Pricing
View Details
Recombinant Mouse LIGHT/TNFSF14 Protein
NBP2-61332-5ug 5 µg

Recombinant Mouse LIGHT/TNFSF14 Protein

Sign In for Pricing
View Details
Anti-CSF2 / GM-CSF Reference Antibody (lenzilumab)
M00911-2 100 µg

Anti-CSF2 / GM-CSF Reference Antibody (lenzilumab)

Sign In for Pricing
View Details
APOL6 Human qPCR Template Standard (NM_030641)
HK211209 1 Kit

APOL6 Human qPCR Template Standard (NM_030641)

Sign In for Pricing
View Details
Glycopyrronium Iodide-13C-D3
RM-G122727-01 10 mg

Glycopyrronium Iodide-13C-D3

Sign In for Pricing
View Details
Glycopyrronium Iodide-13C-D3
RM-G122727-02 25 mg

Glycopyrronium Iodide-13C-D3

Sign In for Pricing
View Details