Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRP1, Human (HEK293, His)

SFRP1 protein is a soluble Frizzled-related protein (sFRP) that regulates Wnt signaling by directly interacting with Wnt, affecting cell growth and differentiation. Notably, it reduces intracellular β-catenin levels and affects Wnt pathway components. SFRP1 Protein, Human (HEK293, His) is the recombinant human-derived SFRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

SFRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sfrp1-protein-human-hek293-his.html

Purity

97.00

Smiles

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

Molecular Formula

6422 (Gene_ID) Q8N474 (S32-K314) (Accession)

Molecular Weight

Approximately 35-43 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gemin4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6314405 3x 1.0 µg

Gemin4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
KLRA1 (KLRA1P) Rabbit Polyclonal Antibody
TA341850 100 µL

KLRA1 (KLRA1P) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vmn1r256 Mouse Gene Knockout Kit (CRISPR)
KN506831 1 Kit

Vmn1r256 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TLK2 (Tousled-like Kinase 2, Serine/threonine-protein Kinase Tousled-like 2, HsHPK, PKU-alpha) (FITC)
MBS6150125-01 0.1 mL

TLK2 (Tousled-like Kinase 2, Serine/threonine-protein Kinase Tousled-like 2, HsHPK, PKU-alpha) (FITC)

Sign In for Pricing
View Details
TLK2 (Tousled-like Kinase 2, Serine/threonine-protein Kinase Tousled-like 2, HsHPK, PKU-alpha) (FITC)
MBS6150125-02 5x 0.1 mL

TLK2 (Tousled-like Kinase 2, Serine/threonine-protein Kinase Tousled-like 2, HsHPK, PKU-alpha) (FITC)

Sign In for Pricing
View Details
Rabbit Monoclonal c-Myc Antibody (MYC/7854R)
NBP3-20492-100ug 100 µg

Rabbit Monoclonal c-Myc Antibody (MYC/7854R)

Sign In for Pricing
View Details