Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (Cox4i1), partial

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit IV isoform 1; COX IV-1

Abbreviation

Recombinant Mouse Cox4i1 protein, partial

Gene Name

Cox4i1

UniProt

P19783

Expression Region

23-98aa

Organism

Mus musculus (Mouse)

Target Sequence

AHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTN

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU (A) ) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU (B) ) . The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) ) (BSA & Azide Free) (MaxLight 405) discontinued
168807-AF-ML405 100 µL

IL-6 (B cell differentiation factor, B Cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Cytotoxic T cell differentiation factor, Hepatocyte stimulating factor, HPGF, HSF, Hybridoma growth factor (HGF), Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor, IFN-beta-2, IFNB2, Interferon beta-2, Interleukin 6 (interferon beta 2) ) (BSA & Azide Free) (MaxLight 405) discontinued

Ask
View Details
Ethe1 Mouse shRNA Lentiviral Particle (Locus ID 66071)
TL516787V 500 µL Each

Ethe1 Mouse shRNA Lentiviral Particle (Locus ID 66071)

Ask
View Details
SNCAIP Protein Lysate (Mouse) with C-HA Tag
44542034 100 µg

SNCAIP Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Total Iron-binding Capacity Microplate Assay Kit
RDSM222 100 Assays

Total Iron-binding Capacity Microplate Assay Kit

Ask
View Details
Cathepsin D
PR010-3ml 3 mL

Cathepsin D

Ask
View Details
Tight Junction Protein 1 Recombinant Protein Antigen
NBP1-85047PEP 0.1 mL

Tight Junction Protein 1 Recombinant Protein Antigen

Ask
View Details