Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probetacellulin [Cleaved into: Betacellulin protein (BTC), partial (Active)

Product Specifications

Product Name Alternative

BTC

Abbreviation

Recombinant Human BTC protein, partial (Active)

Gene Name

BTC

UniProt

P35070

Expression Region

32-111aa

Organism

Homo sapiens (Human)

Target Sequence

DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Signal Transduction

Relevance

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. {ECO:0000269|PubMed:8570211}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 x 107 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Molecular Weight

9.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ST6GALNAC4 shRNA (UAS) - Lentiviral human ST6GALNAC4 shRNA (UAS) (25)
GTR15083477 1 Vial

Lentiviral human ST6GALNAC4 shRNA (UAS) - Lentiviral human ST6GALNAC4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lymphotactin (LPTN, LTN, ATAC, C Motif Chemokine 1, Chemokine (C Motif) Ligand 1, Cytokine SCM-1, Lymphotaxin, SCM1, SCM-1, SCM-1-alpha, SCM-1a, Small-inducible Cytokine C1, SCYC1, XC Chemokine Ligand 1, XCL1) (MaxLight 650)
MBS6485646-01 0.1 mL

Lymphotactin (LPTN, LTN, ATAC, C Motif Chemokine 1, Chemokine (C Motif) Ligand 1, Cytokine SCM-1, Lymphotaxin, SCM1, SCM-1, SCM-1-alpha, SCM-1a, Small-inducible Cytokine C1, SCYC1, XC Chemokine Ligand 1, XCL1) (MaxLight 650)

Sign In for Pricing
View Details
Lymphotactin (LPTN, LTN, ATAC, C Motif Chemokine 1, Chemokine (C Motif) Ligand 1, Cytokine SCM-1, Lymphotaxin, SCM1, SCM-1, SCM-1-alpha, SCM-1a, Small-inducible Cytokine C1, SCYC1, XC Chemokine Ligand 1, XCL1) (MaxLight 650)
MBS6485646-02 5x 0.1 mL

Lymphotactin (LPTN, LTN, ATAC, C Motif Chemokine 1, Chemokine (C Motif) Ligand 1, Cytokine SCM-1, Lymphotaxin, SCM1, SCM-1, SCM-1-alpha, SCM-1a, Small-inducible Cytokine C1, SCYC1, XC Chemokine Ligand 1, XCL1) (MaxLight 650)

Sign In for Pricing
View Details
Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CAL
MBS6466623-01 0.1 mL

Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CAL

Sign In for Pricing
View Details
Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CAL
MBS6466623-02 5x 0.1 mL

Calcitonin Gene Related Peptide (CGRP, Calcitonin Gene-related Peptide 1, CGRP1, Calcitonin Gene-related Peptide I, CGRP I, CGRP-I, Alpha Type CGRP, CAL6, Cal1, Calc, Calcitonin 1, CALC 1, CALC 2, RATCAL6, Calcitonin-related Polypeptide alpha, CALC A, CAL

Sign In for Pricing
View Details
Trypsin Activity Assay
AKR-MA-0128 100 Well

Trypsin Activity Assay

Sign In for Pricing
View Details