Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-11R alpha, Rat (HEK293, His)

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas[5]. IL-11R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 366 amino acids (M1-Q366) and is produced by HEK293 cells.

Product Specifications

Product Name Alternative

IL-11R alpha Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-11r-alpha-protein-rat-hek293-his.html

Purity

98.00

Smiles

TPCPQAWGPPGVQYGQPGRPVMLCCPGVNAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSRDEGTYVCRTLDGVFGGMVTLKLGSPPARPEVSCQAVDYENFSCTWSPGRVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQRILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLRDEVPDGSRGHEQKLEAAAQEDSPAPPSPSLQPDPRPLDHRDPLEQ

Molecular Formula

245983 (Gene_ID) Q99MF4 /NP_620816.1 (T24-Q366) (Accession)

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

References & Citations

[1]Schafer S, et al. IL-11 is a crucial determinant of cardiovascular fibrosis. Nature. 2017 Dec 7;552 (7683) :110-115. |[2][2]Cook SA, et al. Hiding in Plain Sight: Interleukin-11 Emerges as a Master Regulator of Fibrosis, Tissue Integrity, and Stromal Inflammation. Annu Rev Med. 2020 Jan 27;71:263-276. |[3]Balakrishnan L, et al. IL-11/IL11RA receptor mediated signaling: a web accessible knowledgebase. Cell Commun Adhes. 2013 Aug;20 (3-4) :81-6.|[4]Dams-Kozlowska H, et al. A designer hyper interleukin 11 (H11) is a biologically active cytokine. BMC Biotechnol. 2012 Mar 21;12:8.|[5]Nakayama T, et al. Expression of interleukin-11 (IL-11) and IL-11 receptor alpha in human gastric carcinoma and IL-11 upregulates the invasive activity of human gastric carcinoma cells. Int J Oncol. 2007 Apr;30 (4) :825-33.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195 + 31G7), CF647 conjugate, 0.1mg/mL
BNC471200-100 1x 100 µL

EGFR (GFR1195 + 31G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details