Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Persephin, Human

Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Persephin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/persephin-protein-human.html

Purity

99.9

Smiles

ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Molecular Formula

5623 (Gene_ID) O60542 (A61-G156) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tau (Ser416) Rabbit Polyclonal Antibody (PE)
orb505899 100 µL

Phospho-Tau (Ser416) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
IL-2 ELISpot Assay Kit
IL231-ES 1 Kit

IL-2 ELISpot Assay Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit
MBS7259528-01 48 Well

Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit
MBS7259528-02 96 Well

Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit
MBS7259528-03 5x 96 Well

Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit
MBS7259528-04 10x 96 Well

Goat Olfactory Receptor 6B2 (OR6B2) ELISA Kit

Sign In for Pricing
View Details