Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP2/I-FABP, Human (His)

FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP2/I-FABP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp2-i-fabp-protein-human-his.html

Purity

98.0

Smiles

MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Molecular Formula

2169 (Gene_ID) P12104 (M1-D132) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-mouse/rat CD81
E16FMU081-050U 50 µg

Purified anti-mouse/rat CD81

Sign In for Pricing
View Details
4-Ethyl-2-methylthiophene
NAA67854-01 50 mg

4-Ethyl-2-methylthiophene

Sign In for Pricing
View Details
4-Ethyl-2-methylthiophene
NAA67854-02 0.5 g

4-Ethyl-2-methylthiophene

Sign In for Pricing
View Details
Mmu-miR-12196-5p inhibitor
HY-RI02619-01 5 nmol

Mmu-miR-12196-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-12196-5p inhibitor
HY-RI02619-02 20 nmol

Mmu-miR-12196-5p inhibitor

Sign In for Pricing
View Details
Lentiviral human PSMB4 shRNA (UAS) - Lentiviral human PSMB4 shRNA (UAS, GFP) plasmid
GTR15158878 1 Vial

Lentiviral human PSMB4 shRNA (UAS) - Lentiviral human PSMB4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details