Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Mouse

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-10 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-mouse.html

Purity

98.0

Smiles

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Molecular Formula

16153 (Gene_ID) P18893 (S19-S178) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMOD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV666828 1.0 µg DNA

LMOD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Anti-Reovirus Type 3 Antibody (Anti-REO-3) ELISA Kit
abx392544 96 Tests

Mouse Anti-Reovirus Type 3 Antibody (Anti-REO-3) ELISA Kit

Sign In for Pricing
View Details
FOXP3 Human Pre-designed siRNA Set A
HY-RS05075 1 Set

FOXP3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
R-cadherin Double Nickase Plasmid (h)
sc-418291-NIC 20 µg

R-cadherin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PLK2 Rabbit Polyclonal Antibody
orb630012-01 50 µg

PLK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLK2 Rabbit Polyclonal Antibody
orb630012-02 100 µg

PLK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details