Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial

Product Specifications

Product Name Alternative

(Sodium channel protein brain I subunit alpha) (Sodium channel protein type I subunit alpha) (Voltage-gated sodium channel subunit alpha Nav1.1)

Abbreviation

Recombinant Human SCN1A protein, partial

Gene Name

SCN1A

UniProt

P35498

Expression Region

1-128aa

Organism

Homo sapiens (Human)

Target Sequence

MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. Plays a key role in brain, probably by regulating the moment when neurotransmitters are released in neurons. Involved in sensory perception of mechanical pain: activation in somatosensory neurons induces pain without neurogenic inflammation and produces hypersensitivity to mechanical, but not thermal stimuli.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

References & Citations

"The tarantula toxin beta/delta-TRTX-Pre1a highlights the importance of the S1-S2 voltage-sensor region for sodium channel subtype selectivity." Wingerd J.S., Mozar C.A., Ussing C.A., Murali S.S., Chin Y.K., Cristofori-Armstrong B., Durek T., Gilchrist J., Vaughan C.W., Bosmans F., Adams D.J., Lewis R.J., Alewood P.F., Mobli M., Christie M.J., Rash L.D. Sci. Rep. 7:974-988 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL7R Human
32-6438-5 5 µg

IL7R Human

Ask
View Details
UPK3B Rabbit Polyclonal Antibody
TA362358 100 µL

UPK3B Rabbit Polyclonal Antibody

Ask
View Details
BRG1 (SMARCA4) (NM_001128847) Human Tagged Lenti ORF Clone
RC226411L4 10 µg

BRG1 (SMARCA4) (NM_001128847) Human Tagged Lenti ORF Clone

Ask
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (Biotin)
MBS6174315-01 0.1 mL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (Biotin)

Ask
View Details
CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (Biotin)
MBS6174315-02 5x 0.1 mL

CYP1A2 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2, CP12, P3-450, P450(PA)) (Biotin)

Ask
View Details
Goat anti-Glu-Glu Tag Antibody Affinity Purified
MBS3900633-01 0.1 mg

Goat anti-Glu-Glu Tag Antibody Affinity Purified

Ask
View Details