Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mammaglobin-A (SCGB2A2)

Product Specifications

CAS Number

9000-83-3

Gene Name

SCGB2A2

UniProt

Q13296

Expression Region

1-93aa

Organism

Homo sapiens

Target Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Tag

N-terminal GST-tagged

Source

E.coli

Field of Research

Tags & Cell Markers

Assay Type

In Stock Protein

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.5 kDa

References & Citations

"Mammaglobin a in breast cancer: eXIstence of multiple molecular forms." O'Brien N.A., O'Donovan N., Ryan B., Hill A.D., McDermott E., O'Higgins N., Duffy M.J. Int. J. Cancer 114:623-627 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (C1A/711), CF594 conjugate, 0.1mg/mL
BNC940711-100 1x 100 µL

CD1a (C1A/711), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF594 conjugate, 0.1mg/mL
BNC942895-500 1x 500 µL

C-Myc Oncoprotein (MYC2895R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF640R conjugate, 0.1mg/mL
BNC400705-100 1x 100 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details