Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP-17, Human (His)

The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SP-17 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sp-17-protein-human-his-solutin.html

Purity

95.00

Smiles

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK

Molecular Formula

53340 (Gene_ID) Q15506 (M1-K151) (Accession)

Molecular Weight

20-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lung Specific Antigen (LSA120), 1mg/mL
BNUM0120-50 1x 50 µL

Lung Specific Antigen (LSA120), 1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), 1mg/mL
BNUM2883-50 1x 50 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB523679 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Dicyclohexylamine
TRC-D438300-5G 5 g

Dicyclohexylamine

Sign In for Pricing
View Details
CALCOCO2 Antibody
KC-2104-01 50 μL

CALCOCO2 Antibody

Sign In for Pricing
View Details
CALCOCO2 Antibody
KC-2104-02 100 µL

CALCOCO2 Antibody

Sign In for Pricing
View Details