Question 1

What is the catalog number for Eps15, phosphorylated (Y849)?

Accepted Answer

The catalog number for Eps15, phosphorylated (Y849) is 328601.

Question 2

What sizes are available for Eps15, phosphorylated (Y849)?

Accepted Answer

Eps15, phosphorylated (Y849) is available in the following size(s): 50 µg, 100 µg.

Question 3

How many pack sizes does Eps15, phosphorylated (Y849) come in?

Accepted Answer

Eps15, phosphorylated (Y849) is available in 2 different pack sizes.

Question 4

Is Eps15, phosphorylated (Y849) in stock?

Accepted Answer

Eps15, phosphorylated (Y849) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 5

What buffer is this product supplied in?

Accepted Answer

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

Question 6

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

Accepted Answer

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Question 7

Can I request a Safety Data Sheet (SDS) for this product?

Accepted Answer

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Eps15, phosphorylated (Y849)

Product Specifications

Clonality

Available Sizes

Frequently Asked Questions

Explore Other Products

Mouse Complement Fragment 3B (C3B) ELISA Kit

Mouse Complement Fragment 3B (C3B) ELISA Kit

Mouse Complement Fragment 3B (C3B) ELISA Kit

Mouse Complement Fragment 3B (C3B) ELISA Kit

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA