Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial

Product Specifications

Product Name Alternative

(GLP-2 receptor) (GLP-2-R) (GLP-2R)

Abbreviation

Recombinant Human GLP2R protein, partial

Gene Name

GLP2R

UniProt

O95838

Expression Region

1-173aa

Organism

Homo sapiens (Human)

Target Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

References & Citations

"The glucagon-like peptide-2 receptor C terminus modulates beta-arrestin-2 association but is dispensable for ligand-induced desensitization, endocytosis, and G-protein-dependent effector activation." Estall J.L., Koehler J.A., Yusta B., Drucker D.J. J Biol Chem 280:22124-22134 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)
236224-01 1 g

Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)

Sign In for Pricing
View Details
Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)
236224-02 5 g

Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)

Sign In for Pricing
View Details
Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)
236224-03 25 g

Boc-D-phenylalanine N-hydrosuccinimide ester 99+% (HPLC)

Sign In for Pricing
View Details
Human GIPC (GIPC1) (NM_005716) AAV Particle
RC216466A1V 250 µL

Human GIPC (GIPC1) (NM_005716) AAV Particle

Sign In for Pricing
View Details
Recombinant Mouse EFCAB1 Protein, His (Fc)-Avi-tagged
EFCAB1-2653M 50 µg

Recombinant Mouse EFCAB1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Monoclonal PMS2 Antibody (163C1251) [mFluor Violet 500 SE]
NB100-56554MFV500 0.1 mL

Mouse Monoclonal PMS2 Antibody (163C1251) [mFluor Violet 500 SE]

Sign In for Pricing
View Details