Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA)

Product Specifications

Product Name Alternative

(Pediocin ACH)

Abbreviation

Recombinant Pediococcus acidilactici pedA protein

Gene Name

PedA

UniProt

P29430

Expression Region

19-62aa

Organism

Pediococcus acidilactici

Target Sequence

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Bactericidal activity (effective inhibitor of L.monocytogenes) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

References & Citations

"Synthesis, antimicrobial activity and conformational analysis of the class IIa bacteriocin pediocin PA-1 and analogs thereof." Bedard F., Hammami R., Zirah S., Rebuffat S., Fliss I., Biron E. Sci Rep 8:9029-9029 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7250106 1.0 µg DNA

Spata4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Vesicular Stomatitis Indiana Virus Nucleoprotein (VSIV N) Antibody
abx461744-01 100 µg

Vesicular Stomatitis Indiana Virus Nucleoprotein (VSIV N) Antibody

Sign In for Pricing
View Details
Vesicular Stomatitis Indiana Virus Nucleoprotein (VSIV N) Antibody
abx461744-02 1 mg

Vesicular Stomatitis Indiana Virus Nucleoprotein (VSIV N) Antibody

Sign In for Pricing
View Details
Phospho-M ERBB2(Y1140) Blocking Peptide
MBS9230769-01 0.5 mg

Phospho-M ERBB2(Y1140) Blocking Peptide

Sign In for Pricing
View Details
Phospho-M ERBB2(Y1140) Blocking Peptide
MBS9230769-02 5x 0.5 mg

Phospho-M ERBB2(Y1140) Blocking Peptide

Sign In for Pricing
View Details
IL17RA Protein (C-human IgG1-Fc, Rhesus)
P525725 100 µg

IL17RA Protein (C-human IgG1-Fc, Rhesus)

Sign In for Pricing
View Details