Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA)

Product Specifications

Product Name Alternative

(Pediocin ACH)

Abbreviation

Recombinant Pediococcus acidilactici pedA protein

Gene Name

PedA

UniProt

P29430

Expression Region

19-62aa

Organism

Pediococcus acidilactici

Target Sequence

KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC

Tag

N-terminal 6xHis-KSI-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Bactericidal activity (effective inhibitor of L.monocytogenes) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.0 kDa

References & Citations

"Synthesis, antimicrobial activity and conformational analysis of the class IIa bacteriocin pediocin PA-1 and analogs thereof." Bedard F., Hammami R., Zirah S., Rebuffat S., Fliss I., Biron E. Sci Rep 8:9029-9029 (2018)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (NM_007294) Human Mutant ORF Clone
RC403043 10 µg

BRCA1 (NM_007294) Human Mutant ORF Clone

Sign In for Pricing
View Details
Anti-INF2 Rabbit pAb
GB115034-50 50 μL

Anti-INF2 Rabbit pAb

Sign In for Pricing
View Details
TentaGel® S FMP
S30016.1G 1 g

TentaGel® S FMP

Sign In for Pricing
View Details
Chicken MSTN (Myostatin) ELISA Kit
MBS2513618-01 24 Tests

Chicken MSTN (Myostatin) ELISA Kit

Sign In for Pricing
View Details
Chicken MSTN (Myostatin) ELISA Kit
MBS2513618-02 48 Tests

Chicken MSTN (Myostatin) ELISA Kit

Sign In for Pricing
View Details
Chicken MSTN (Myostatin) ELISA Kit
MBS2513618-03 96 Tests

Chicken MSTN (Myostatin) ELISA Kit

Sign In for Pricing
View Details