Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEGF6 Antibody
MBS9419453-01 0.05 mL

MEGF6 Antibody

Sign In for Pricing
View Details
MEGF6 Antibody
MBS9419453-02 0.1 mL

MEGF6 Antibody

Sign In for Pricing
View Details
MEGF6 Antibody
MBS9419453-03 5x 0.1 mL

MEGF6 Antibody

Sign In for Pricing
View Details
ATP5J2P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0150007 1.0 µg DNA

ATP5J2P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mbtps2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4869907 1.0 µg DNA

Mbtps2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Family With Sequence Similarity 3, Member A (FAM3A) Antibody
abx376012 100 µg

Family With Sequence Similarity 3, Member A (FAM3A) Antibody

Sign In for Pricing
View Details