Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DUS1L Antibody
NBP3-06506-100ul 100 µL

Rabbit Polyclonal DUS1L Antibody

Sign In for Pricing
View Details
Rat Hemoglobin ELISA Kit
GWB-D51A86 96 Well

Rat Hemoglobin ELISA Kit

Sign In for Pricing
View Details
2- (5-Chloro-2-methoxyphenyl) -5-fluorobenzoic acid
413908-01 100 mg

2- (5-Chloro-2-methoxyphenyl) -5-fluorobenzoic acid

Sign In for Pricing
View Details
2- (5-Chloro-2-methoxyphenyl) -5-fluorobenzoic acid
413908-02 250 mg

2- (5-Chloro-2-methoxyphenyl) -5-fluorobenzoic acid

Sign In for Pricing
View Details
Lentiviral human KCP sgRNA gene knockout kit - Lentiviral human KCP sgRNA gene knockout kit (25)
GTR15381837 1 Vial

Lentiviral human KCP sgRNA gene knockout kit - Lentiviral human KCP sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Monoclonal [clone 3E8] (IgG1) to Human ATM
MBS245062-01 0.05 mL

Mouse Monoclonal [clone 3E8] (IgG1) to Human ATM

Sign In for Pricing
View Details