Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Glucagon Receptor antibody
STJ93282 200 µl

Anti-Glucagon Receptor antibody

Sign In for Pricing
View Details
amfiXpand PCR Master Mix
P0331-250 50x 50 Reactions

amfiXpand PCR Master Mix

Sign In for Pricing
View Details
RGD1561958 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39263126 3x 1.0µg DNA

RGD1561958 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)
VK721010-01 50 µg

InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)

Sign In for Pricing
View Details
InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)
VK721010-02 100 µg

InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)

Sign In for Pricing
View Details
InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)
VK721010-03 1 mg

InVivoMAb Anti-JUNV GP1 glycoprotein Antibody (JUN1#)

Sign In for Pricing
View Details