Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT
E1992Mo-01 48 Well

Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT

Sign In for Pricing
View Details
Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT
E1992Mo-02 96 Well

Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT

Sign In for Pricing
View Details
Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT
E1992Mo-03 5x 96 Tests

Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT

Sign In for Pricing
View Details
Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT
E1992Mo-04 10x 96 Tests

Mouse Cytochrome b-245 heavy chain, CYBB ELISA KIT

Sign In for Pricing
View Details
TRNAC7 3'UTR Luciferase Stable Cell Line
TU026682 1.0 mL

TRNAC7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal RASGRF1 Antibody [Alexa Fluor 488]
NBP3-06655AF488 0.1 mL

Rabbit Polyclonal RASGRF1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details