Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULT2A1 Recombinant Protein (Human)
RP030610 100 µg

SULT2A1 Recombinant Protein (Human)

Sign In for Pricing
View Details
GAGE2A Protein Vector (Human) (pPM-C-His)
PV079904 500 ng

GAGE2A Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Resistin Antibody (RRES 07) [Allophycocyanin]
NBP2-80032APC 0.1 mL

Mouse Monoclonal Resistin Antibody (RRES 07) [Allophycocyanin]

Sign In for Pricing
View Details
Hepacam2 (NM_178899) Mouse Tagged ORF Clone Lentiviral Particle
MR207387L4V 200 µL

Hepacam2 (NM_178899) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SCG3 Antibody
A34194-100UL 100 µL

SCG3 Antibody

Sign In for Pricing
View Details
DARS (Aspartate--tRNA Ligase, Cytoplasmic, Aspartyl-tRNA Synthetase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) discontinued
360086-01 50 µL

DARS (Aspartate--tRNA Ligase, Cytoplasmic, Aspartyl-tRNA Synthetase, AspRS, Cell Proliferation-inducing Gene 40 Protein, PIG40) discontinued

Sign In for Pricing
View Details