Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTULIN Lentiviral Activation Particles (m)
sc-436617-LAC 200 µL

OTULIN Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Phospho-JNK1/2/3 (Thr183+Tyr185) Antibody
AF3318-01 100 µL

Phospho-JNK1/2/3 (Thr183+Tyr185) Antibody

Sign In for Pricing
View Details
Phospho-JNK1/2/3 (Thr183+Tyr185) Antibody
AF3318-02 200 µL

Phospho-JNK1/2/3 (Thr183+Tyr185) Antibody

Sign In for Pricing
View Details
hsa-miR-6781-3p miRNA Antagomir
MNH03523 2x 5.0 nmol

hsa-miR-6781-3p miRNA Antagomir

Sign In for Pricing
View Details
PRNP Protein Vector (Human) (pPM-C-His)
PV032912 500 ng

PRNP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
RNA-binding protein 25 (RBM25) Mouse ELISA Kit
G8291 96 Tests

RNA-binding protein 25 (RBM25) Mouse ELISA Kit

Sign In for Pricing
View Details