Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP citrate lyase (ACLY) (NM_001096) Human Tagged ORF Clone Lentiviral Particle
RC200508L2V 200 µL

ATP citrate lyase (ACLY) (NM_001096) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPL23AP52 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV778587 1.0 µg DNA

RPL23AP52 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Dgka Mouse shRNA Lentiviral Particle (Locus ID 13139)
TL500496V 500 µL Each

Dgka Mouse shRNA Lentiviral Particle (Locus ID 13139)

Sign In for Pricing
View Details
POSTN (12F2) Mouse Monoclonal antibody
E28PE0902 100 µL

POSTN (12F2) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Human Cytochrome P450 26A1 (CYP26A1) ELISA Kit
abx252303-01 96 Tests

Human Cytochrome P450 26A1 (CYP26A1) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome P450 26A1 (CYP26A1) ELISA Kit
abx252303-02 5x 96 Tests

Human Cytochrome P450 26A1 (CYP26A1) ELISA Kit

Sign In for Pricing
View Details