Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IER3IP1 Human qPCR Primer Pair (NM_016097)
HP211977 200 Reactions

IER3IP1 Human qPCR Primer Pair (NM_016097)

Sign In for Pricing
View Details
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121) (MaxLight 405)
MBS6189505-01 0.1 mL

CLIC2 (Chloride Intracellular Channel Protein 2, XAP121) (MaxLight 405)

Sign In for Pricing
View Details
CLIC2 (Chloride Intracellular Channel Protein 2, XAP121) (MaxLight 405)
MBS6189505-02 5x 0.1 mL

CLIC2 (Chloride Intracellular Channel Protein 2, XAP121) (MaxLight 405)

Sign In for Pricing
View Details
p53 (TP53) pSer33 Rabbit Polyclonal Antibody
AP08003PU-N 100 µL

p53 (TP53) pSer33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD79B Antibody (IGB/1844) [DyLight 594]
NBP3-08597DL594 100 µL

Mouse Monoclonal CD79B Antibody (IGB/1844) [DyLight 594]

Sign In for Pricing
View Details
CIDE-A, NT (Cell Death-inducing DFF-like Effector A) (AP) discontinued
C5072-02-AP 100 µL

CIDE-A, NT (Cell Death-inducing DFF-like Effector A) (AP) discontinued

Sign In for Pricing
View Details