Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDXD1, CT (PDXDC1, KIAA0251, Pyridoxal-dependent decarboxylase domain-containing protein 1) (MaxLight 490) discontinued
039858-ML490 100 µL

PDXD1, CT (PDXDC1, KIAA0251, Pyridoxal-dependent decarboxylase domain-containing protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human GLB1L shRNA (UAS) - Lentiviral human GLB1L shRNA (UAS, RFP) plasmid
GTR15317392 1 Vial

Lentiviral human GLB1L shRNA (UAS) - Lentiviral human GLB1L shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rat Monoclonal CLEC9a Antibody (397) [DyLight 550]
NBP2-50168R 0.1 mL

Rat Monoclonal CLEC9a Antibody (397) [DyLight 550]

Sign In for Pricing
View Details
BANF1 (Barrier-to-autointegration Factor, Breakpoint Cluster Region Protein 1, BAF, BCRG1, D14S1460, MGC111161) (Biotin)
123826-Biotin 100 µL

BANF1 (Barrier-to-autointegration Factor, Breakpoint Cluster Region Protein 1, BAF, BCRG1, D14S1460, MGC111161) (Biotin)

Sign In for Pricing
View Details
Tectochrysin (Standard)
HY-14592R 1 Each

Tectochrysin (Standard)

Sign In for Pricing
View Details
RADIL siRNA (Human)
CRJ0842-01 15 nmol

RADIL siRNA (Human)

Sign In for Pricing
View Details