Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM167B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46933154 3x 1.0 µg DNA

TMEM167B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PSMD10 Protein Vector (Rat) (pPM-C-HA)
PV296884 500 ng

PSMD10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
pPCRScript-GAGE1 Plasmid
PVT24543 2 µg

pPCRScript-GAGE1 Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal PASD1 Antibody (3C1)
H00139135-M08 0.1 mg

Mouse Monoclonal PASD1 Antibody (3C1)

Sign In for Pricing
View Details
Lentiviral human SCRN2 sgRNA gene knockout kit - Lentiviral human SCRN2 sgRNA gene knockout kit (25)
GTR15357102 1 Vial

Lentiviral human SCRN2 sgRNA gene knockout kit - Lentiviral human SCRN2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
OR7E31P Recombinant Protein (Human)
RP081483 100 µg

OR7E31P Recombinant Protein (Human)

Sign In for Pricing
View Details