Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAE9 CRISPRa sgRNA lentivector (set of three targets)(Human)
48017121 3x 1.0µg DNA

TRNAE9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CHST1 Protein Vector (Human) (pPB-N-His)
PV009446 500 ng

CHST1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Dscam shRNA (UAS) - Lentiviral mouse Dscam shRNA (UAS, RFP) plasmid
GTR15265549 1 Vial

Lentiviral mouse Dscam shRNA (UAS) - Lentiviral mouse Dscam shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MEK6 (MAP2K6), Unactive
MBS517184-01 0.02 mg

MEK6 (MAP2K6), Unactive

Sign In for Pricing
View Details
MEK6 (MAP2K6), Unactive
MBS517184-02 0.1 mg

MEK6 (MAP2K6), Unactive

Sign In for Pricing
View Details
MEK6 (MAP2K6), Unactive
MBS517184-03 1 mg

MEK6 (MAP2K6), Unactive

Sign In for Pricing
View Details