Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ACD Antibody (OTI1A2) [Allophycocyanin]
NBP2-72170APC 0.1 mL

Mouse Monoclonal ACD Antibody (OTI1A2) [Allophycocyanin]

Sign In for Pricing
View Details
(R)-Bambuterol
MBS5811254 Inquire

(R)-Bambuterol

Sign In for Pricing
View Details
pT7T3D-PacI-H4c8 Plasmid
PVT44683 2 µg

pT7T3D-PacI-H4c8 Plasmid

Sign In for Pricing
View Details
Resibufogenin
ALX-350-286-M010 10 mg

Resibufogenin

Sign In for Pricing
View Details
PLVX-Puro-HA-USP51 (human)
BZ32853 1 Vial

PLVX-Puro-HA-USP51 (human)

Sign In for Pricing
View Details
Dusp13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3992008 1.0 µg DNA

Dusp13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details