Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD8 Antibody[SK1]
AN00337C-01 20 Tests

FITC Anti-Human CD8 Antibody[SK1]

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[SK1]
AN00337C-02 100 Tests

FITC Anti-Human CD8 Antibody[SK1]

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[SK1]
AN00337C-03 2x 100 Tests

FITC Anti-Human CD8 Antibody[SK1]

Sign In for Pricing
View Details
Prune2 sgRNA CRISPR Lentivector set (Mouse)
K4890601 3x 1.0 µg

Prune2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Maltose Binding Protein Antibody (R29) [DyLight 755]
NB100-66609IR 0.125 mL

Mouse Monoclonal Maltose Binding Protein Antibody (R29) [DyLight 755]

Sign In for Pricing
View Details
Khdrbs1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4713907 1.0 µg DNA

Khdrbs1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details