Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PAX3 Antibody (Biotin)
STJ502150 100 µg

Anti-PAX3 Antibody (Biotin)

Sign In for Pricing
View Details
Homeobox protein unc-4 homolog (UNCX) Rat ELISA Kit
E1171 96 Tests

Homeobox protein unc-4 homolog (UNCX) Rat ELISA Kit

Sign In for Pricing
View Details
AJAP1 (Shrew-1, Gm573, MOT8, Adherens Junction Associated Protein 1)
145381 100 µg

AJAP1 (Shrew-1, Gm573, MOT8, Adherens Junction Associated Protein 1)

Sign In for Pricing
View Details
CCR10, NT (CCR10, GPR2, C-C chemokine receptor type 10, G-protein coupled receptor 2) (MaxLight 405) discontinued
033429-ML405 100 µL

CCR10, NT (CCR10, GPR2, C-C chemokine receptor type 10, G-protein coupled receptor 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RGD1311605 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39143126 3x 1.0µg DNA

RGD1311605 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
FKBP2 antibody
70R-17310 50 ul

FKBP2 antibody

Sign In for Pricing
View Details