Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fbxo8 Pre-designed siRNA Set A
SI104817A 1 Each

Mouse Fbxo8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human VEGFR-3/FLT-4 ELISA (total)
MBS691467-01 0.096 mg

Human VEGFR-3/FLT-4 ELISA (total)

Sign In for Pricing
View Details
Human VEGFR-3/FLT-4 ELISA (total)
MBS691467-02 5x 0.09 6mg

Human VEGFR-3/FLT-4 ELISA (total)

Sign In for Pricing
View Details
Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-1C12) [DyLight 650]
NBP3-26930C 0.1 mL

Mouse Monoclonal SNW1 Antibody (PCRP-SNW1-1C12) [DyLight 650]

Sign In for Pricing
View Details
Olfr171 Protein Vector (Mouse) (pPM-C-HA)
PV209688 500 ng

Olfr171 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MTHFD1 Rabbit Polyclonal Antibody (Center P550)
E28PB2114 100 µL

MTHFD1 Rabbit Polyclonal Antibody (Center P550)

Sign In for Pricing
View Details