Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm15104 (NM_001101501) Mouse Tagged ORF Clone Lentiviral Particle
MR213553L4V 200 µL

Gm15104 (NM_001101501) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SF3A1 (NM_001005409) Human Tagged ORF Clone
RG218372 10 µg

SF3A1 (NM_001005409) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CD99 Pre-designed siRNA Set B
SI002613B 1 Each

Human CD99 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Monkey Bone Marrow Primary Macrophages
CC7F991 2x 10^6 Cells/Vial

Monkey Bone Marrow Primary Macrophages

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 PKHD-type hydroxylase ybiX (ybiX)
MBS1207492-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 18 PKHD-type hydroxylase ybiX (ybiX)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 18 PKHD-type hydroxylase ybiX (ybiX)
MBS1207492-02 0.1 mg (E-Coli)

Recombinant Shigella boydii serotype 18 PKHD-type hydroxylase ybiX (ybiX)

Sign In for Pricing
View Details