Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta E chain (INHBE) (NM_031479) Human Tagged ORF Clone
RG201426 10 µg

Inhibin beta E chain (INHBE) (NM_031479) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Olfactory receptor 51B4 (OR51B4) ELISA Kit
abx536502 96 Tests

Human Olfactory receptor 51B4 (OR51B4) ELISA Kit

Sign In for Pricing
View Details
Hippocalcin-Like protein 1 (HPCAL1) Rat ELISA Kit
E0351 96 Tests

Hippocalcin-Like protein 1 (HPCAL1) Rat ELISA Kit

Sign In for Pricing
View Details
IWP-2 (N- (6-Methyl-2-benzothiazolyl) -2-[ (3,4,6,7-tetrahydro-4-oxo-3-phenylthieno[3,2-d]pyrimidin-2-yl) thio]-acetamide) discontinued
167891-01 5 mg

IWP-2 (N- (6-Methyl-2-benzothiazolyl) -2-[ (3,4,6,7-tetrahydro-4-oxo-3-phenylthieno[3,2-d]pyrimidin-2-yl) thio]-acetamide) discontinued

Sign In for Pricing
View Details
IWP-2 (N- (6-Methyl-2-benzothiazolyl) -2-[ (3,4,6,7-tetrahydro-4-oxo-3-phenylthieno[3,2-d]pyrimidin-2-yl) thio]-acetamide) discontinued
167891-02 25 mg

IWP-2 (N- (6-Methyl-2-benzothiazolyl) -2-[ (3,4,6,7-tetrahydro-4-oxo-3-phenylthieno[3,2-d]pyrimidin-2-yl) thio]-acetamide) discontinued

Sign In for Pricing
View Details
UBE3AP2 Recombinant Protein (Human)
RP106268 100 µg

UBE3AP2 Recombinant Protein (Human)

Sign In for Pricing
View Details