Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf98 Recombinant Protein (Human)
RP005347 100 µg

C9orf98 Recombinant Protein (Human)

Sign In for Pricing
View Details
FACL6 Antibody (Center) Blocking Peptide
MBS9224712-01 0.5 mg

FACL6 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
FACL6 Antibody (Center) Blocking Peptide
MBS9224712-02 5x 0.5 mg

FACL6 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mir150 Mouse qPCR Template Standard (MI0000172)
MK300076 200 Reactions

Mir150 Mouse qPCR Template Standard (MI0000172)

Sign In for Pricing
View Details
TRAF7 Polyclonal Antibody
MBS9140607-01 0.02 mL

TRAF7 Polyclonal Antibody

Sign In for Pricing
View Details
TRAF7 Polyclonal Antibody
MBS9140607-02 0.1 mL

TRAF7 Polyclonal Antibody

Sign In for Pricing
View Details