Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV Nucleocapsid Protein
abx060653 1 mg

SARS-CoV Nucleocapsid Protein

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 490)
MBS6389895-01 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 490)

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 490)
MBS6389895-02 5x 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 490)

Sign In for Pricing
View Details
Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1)
MBS644617-01 0.2 mL

Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1)

Sign In for Pricing
View Details
Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1)
MBS644617-02 5x 0.2 mL

Senp1, ID (Senp1, Supr2, Sentrin-specific protease 1, SUMO-1 protease 2, Sentrin/SUMO-specific protease SENP1)

Sign In for Pricing
View Details
Rabbit Polyclonal Acetoacetyl CoA synthetase Antibody [Alexa Fluor 488]
NBP2-97174AF488 0.1 mL

Rabbit Polyclonal Acetoacetyl CoA synthetase Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details