Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL48 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV752868 1.0 µg DNA

TRNAL48 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Pig Tissue Premade Western Blot
PW-MT-1 1 Blot

Pig Tissue Premade Western Blot

Sign In for Pricing
View Details
Mouse Prostaglandin B2 (PGB2) ELISA Kit
YP-W20558-01 48 Tests

Mouse Prostaglandin B2 (PGB2) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostaglandin B2 (PGB2) ELISA Kit
YP-W20558-02 96 Tests

Mouse Prostaglandin B2 (PGB2) ELISA Kit

Sign In for Pricing
View Details
SEN1 (MORF4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]
CF800387 100 µg

SEN1 (MORF4) Mouse Monoclonal Antibody [Clone ID: OTI5E6]

Sign In for Pricing
View Details
RN5S133 AAV Vector (Human) (CMV)
39689101 1 µg

RN5S133 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details