Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTR2 Polyclonal Antibody
JOT-AP06206-01 50ul

NTR2 Polyclonal Antibody

Sign In for Pricing
View Details
NTR2 Polyclonal Antibody
JOT-AP06206-02 100ul

NTR2 Polyclonal Antibody

Sign In for Pricing
View Details
Tau (phospho Thr205) Antibody
A7245-01 50 μL

Tau (phospho Thr205) Antibody

Sign In for Pricing
View Details
Tau (phospho Thr205) Antibody
A7245-02 100 µL

Tau (phospho Thr205) Antibody

Sign In for Pricing
View Details
SEC14L4 (NM_174977) Human Tagged Lenti ORF Clone
RC221251L4 10 µg

SEC14L4 (NM_174977) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Muted 3'UTR Luciferase Stable Cell Line
TU113660 1.0 mL

Muted 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details