Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD123 PerCP-Cyanine5.5
MBS1800285-01 100 Tests

Anti-Hu CD123 PerCP-Cyanine5.5

Sign In for Pricing
View Details
Anti-Hu CD123 PerCP-Cyanine5.5
MBS1800285-02 5x 100 Tests

Anti-Hu CD123 PerCP-Cyanine5.5

Sign In for Pricing
View Details
Human Leucine-Rich Repeat And Calponin Homology Domain-Containing Protein 4 (LRCH4) ELISA Kit
RD-LRCH4-Hu-96Tests 96 Tests

Human Leucine-Rich Repeat And Calponin Homology Domain-Containing Protein 4 (LRCH4) ELISA Kit

Sign In for Pricing
View Details
ZNF432 sgRNA CRISPR Lentivector set (Human)
K2705901 3x 1.0 µg

ZNF432 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-LC3A/B antibody
SL20414R-01 50 µL

Rabbit Anti-LC3A/B antibody

Sign In for Pricing
View Details
Rabbit Anti-LC3A/B antibody
SL20414R-02 100 µL

Rabbit Anti-LC3A/B antibody

Sign In for Pricing
View Details