Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF18 Protein Vector (Human) (pPB-C-His)
PV002393 500 ng

ARHGEF18 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) ATG13 Polyclonal Antibody
MBS9015154 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) ATG13 Polyclonal Antibody

Sign In for Pricing
View Details
C11orf82 Protein Vector (Human) (pPB-His-MBP)
PV328458 500 ng

C11orf82 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
CL-P1/COLEC12, Rhesus Macaque (sf9, His)
HY-P77341 1 Each

CL-P1/COLEC12, Rhesus Macaque (sf9, His)

Sign In for Pricing
View Details
Flightless I Lentiviral Activation Particles (h)
sc-401667-LAC 200 µL

Flightless I Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Agomir
CMN0328-01 5 nmol

Mmu-miR-374b-3p miRNA Agomir

Sign In for Pricing
View Details