Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal West Nile Virus C Protein Antibody [Alexa Fluor 700]
NBP2-41054AF700 0.1 mL

Rabbit Polyclonal West Nile Virus C Protein Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (HRP)
MBS6183071-01 0.1 mL

PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (HRP)

Sign In for Pricing
View Details
PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (HRP)
MBS6183071-02 5x 0.1 mL

PPP3CC (Protein Phosphatase 3 (formerly 2B), Catalytic Subunit, gamma isoform, CALNA3) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Cox6c shRNA (UAS) - Lentiviral mouse Cox6c shRNA (UAS, RFP) (25)
GTR15279407 1 Vial

Lentiviral mouse Cox6c shRNA (UAS) - Lentiviral mouse Cox6c shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-RILP antibody
PAab07298 100 µg

Anti-RILP antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 (RLK1), partial
MBS1446144-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 (RLK1), partial

Sign In for Pricing
View Details