Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cofilin-1, Human (His)

Cofilin-1 protein has pH-sensitive F-actin depolymerizing activity and can bind to F-actin. It cooperates with the subcortical maternal complex (SCMC) to guide the fertilized egg through initial embryonic cell division by regulating actin dynamics. Cofilin-1 Protein, Human (His) is the recombinant human-derived Cofilin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Cofilin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cofilin-1-protein-human-his.html

Purity

93.10

Smiles

MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Molecular Formula

1072 (Gene_ID) P23528 (M1-L166) (Accession)

Molecular Weight

Approximately 21 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SETD6 Antibody
NBP2-94127-0.02mL 0.02 mL

Rabbit Polyclonal SETD6 Antibody

Sign In for Pricing
View Details
Rat R-spondin-1 (RSPO1) ELISA Kit
YP-W30127-01 48 Tests

Rat R-spondin-1 (RSPO1) ELISA Kit

Sign In for Pricing
View Details
Rat R-spondin-1 (RSPO1) ELISA Kit
YP-W30127-02 96 Tests

Rat R-spondin-1 (RSPO1) ELISA Kit

Sign In for Pricing
View Details
C14orf166 (RTRAF) Mouse Monoclonal Antibody [Clone ID: OTI2D2]
TA803909 100 µL

C14orf166 (RTRAF) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

Sign In for Pricing
View Details
LentimiRa-mmu-miR-466p-3p Vector
mm40889 500 ng

LentimiRa-mmu-miR-466p-3p Vector

Sign In for Pricing
View Details
HSF1 (Phospho-Ser303) Colorimetric Cell-Based ELISA Kit
MBS9518808-01 1 Kit

HSF1 (Phospho-Ser303) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details