Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Mouse (HEK293)

IL-12 protein is a immune-suppressive heterodimeric cytokine, composed by IL-12A subunit (IL-12p35) and IL-12B subunit (IL-12p40), is naturally produced by dendritic cells[1]. IL-12 exerts functions to activate and link the innate and acquired immune responses[2]. IL-12 Protein, Mouse is produced in HEK293 cells, with tag free.

Product Specifications

Product Name Alternative

IL-12 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-mouse-hek293.html

Purity

98.0

Smiles

RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 20-28 kDa & 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Kaliński P, et al. IL-12-deficient dendritic cells, generated in the presence of prostaglandin E2, promote type 2 cytokine production in maturing human naive T helper cells. J Immunol. 1997 Jul 1;159 (1) :28-35.|[2]Wolf SF, et al. Interleukin 12: a key modulator of immune function. Stem Cells. 1994 Mar;12 (2) :154-68.|[3]Mattner F, et al. Genetically resistant mice lacking interleukin-12 are susceptible to infection with Leishmania major and mount a polarized Th2 cell response. Eur J Immunol. 1996 Jul;26 (7) :1553-9.|[4]Vignali DA, et al. IL-12 family cytokines: immunological playmakers. Nat Immunol. 2012 Jul 19;13 (8) :722-8.|[5]Bacon CM, et al. Interleukin 12 (IL-12) induces tyrosine phosphorylation of JAK2 and TYK2: differential use of Janus family tyrosine kinases by IL-2 and IL-12. J Exp Med. 1995 Jan 1;181 (1) :399-404.|[6]Cua DJ, et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature. 2003 Feb 13;421 (6924) :744-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MYLK3  Polyclonal Antibody
MBS2539373-01 0.06 mL

MYLK3 Polyclonal Antibody

Ask
View Details
MYLK3  Polyclonal Antibody
MBS2539373-02 0.12 mL

MYLK3 Polyclonal Antibody

Ask
View Details
MYLK3  Polyclonal Antibody
MBS2539373-03 0.2 mL

MYLK3 Polyclonal Antibody

Ask
View Details
MYLK3  Polyclonal Antibody
MBS2539373-04 5x 0.2 mL

MYLK3 Polyclonal Antibody

Ask
View Details
MUC2 Antibody, FITC conjugated
A29116-50UG 50 µg

MUC2 Antibody, FITC conjugated

Ask
View Details
Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) Antibody
abx174299 1 mL

Proteolipid Protein 2, Colonic Epithelium Enriched (PLP2) Antibody

Ask
View Details