Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Mouse (HEK293)

IL-12 protein is a immune-suppressive heterodimeric cytokine, composed by IL-12A subunit (IL-12p35) and IL-12B subunit (IL-12p40), is naturally produced by dendritic cells[1]. IL-12 exerts functions to activate and link the innate and acquired immune responses[2]. IL-12 Protein, Mouse is produced in HEK293 cells, with tag free.

Product Specifications

Product Name Alternative

IL-12 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-mouse-hek293.html

Purity

98.0

Smiles

RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Formula

16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)

Molecular Weight

Approximately 20-28 kDa & 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Kaliński P, et al. IL-12-deficient dendritic cells, generated in the presence of prostaglandin E2, promote type 2 cytokine production in maturing human naive T helper cells. J Immunol. 1997 Jul 1;159 (1) :28-35.|[2]Wolf SF, et al. Interleukin 12: a key modulator of immune function. Stem Cells. 1994 Mar;12 (2) :154-68.|[3]Mattner F, et al. Genetically resistant mice lacking interleukin-12 are susceptible to infection with Leishmania major and mount a polarized Th2 cell response. Eur J Immunol. 1996 Jul;26 (7) :1553-9.|[4]Vignali DA, et al. IL-12 family cytokines: immunological playmakers. Nat Immunol. 2012 Jul 19;13 (8) :722-8.|[5]Bacon CM, et al. Interleukin 12 (IL-12) induces tyrosine phosphorylation of JAK2 and TYK2: differential use of Janus family tyrosine kinases by IL-2 and IL-12. J Exp Med. 1995 Jan 1;181 (1) :399-404.|[6]Cua DJ, et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature. 2003 Feb 13;421 (6924) :744-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tetrabutylammonium azide
sc-229391 5 g

Tetrabutylammonium azide

Ask
View Details
Octreotide-13C9,15N
HY-P0036S3 1 Each

Octreotide-13C9,15N

Ask
View Details
C14orf166 (Rtraf) Mouse shRNA Lentiviral Particle (Locus ID 68045)
TL504069V 500 µL Each

C14orf166 (Rtraf) Mouse shRNA Lentiviral Particle (Locus ID 68045)

Ask
View Details
Click EdU-AF555 Cell ProlifeRation Imaging Kit
MBS8579540-01 25 Tests

Click EdU-AF555 Cell ProlifeRation Imaging Kit

Ask
View Details
Click EdU-AF555 Cell ProlifeRation Imaging Kit
MBS8579540-02 50 Tests

Click EdU-AF555 Cell ProlifeRation Imaging Kit

Ask
View Details
Click EdU-AF555 Cell ProlifeRation Imaging Kit
MBS8579540-03 100 Tests

Click EdU-AF555 Cell ProlifeRation Imaging Kit

Ask
View Details