Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAMP3, Human (HEK293, hFc)

RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

RAMP3 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ramp3-protein-human-hek293-hfc.html

Purity

96

Smiles

RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV

Molecular Formula

10268 (Gene_ID) O60896 (R24-V118) (Accession)

Molecular Weight

Approximately 45-60 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRA5/CD85f/ILT11[Biotin], His & Avi, Human
Z04539-100 100 µg

LILRA5/CD85f/ILT11[Biotin], His & Avi, Human

Sign In for Pricing
View Details
HEp-2 Cell Complete Medium
MBS2576350 4x 125 mL

HEp-2 Cell Complete Medium

Sign In for Pricing
View Details
Ikzf1 Antibody - N-terminal region : FITC (ARP57849_P050-FITC)
ARP57849_P050-FITC 100 µL

Ikzf1 Antibody - N-terminal region : FITC (ARP57849_P050-FITC)

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (CTNG/1483), CF488A conjugate, 0.1mg/mL
BNC881483-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (CTNG/1483), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Hydroxy warfarin discontinued
279241-01 1 mg

8-Hydroxy warfarin discontinued

Sign In for Pricing
View Details
8-Hydroxy warfarin discontinued
279241-02 2 mg

8-Hydroxy warfarin discontinued

Sign In for Pricing
View Details