Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arylamine N-acetyltransferase 1 (NAT1)

Product Specifications

Product Name Alternative

Arylamide acetylase 1; Monomorphic arylamine N-acetyltransferase; MNAT; N-acetyltransferase type 1; NAT-1

Abbreviation

Recombinant Human NAT1 protein

Gene Name

NAT1

UniProt

P18440

Expression Region

1-290aa

Organism

Homo sapiens (Human)

Target Sequence

MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM2 (NM_001099787) Human Tagged ORF Clone Lentiviral Particle
RC212720L4V 200 µL

ICAM2 (NM_001099787) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Mouse Heat shock protein beta-11 (Hspb11)
MBS1400738-01 0.02 mg (E-Coli)

Recombinant Mouse Heat shock protein beta-11 (Hspb11)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock protein beta-11 (Hspb11)
MBS1400738-02 0.1 mg (E-Coli)

Recombinant Mouse Heat shock protein beta-11 (Hspb11)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock protein beta-11 (Hspb11)
MBS1400738-03 0.02 mg (Yeast)

Recombinant Mouse Heat shock protein beta-11 (Hspb11)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock protein beta-11 (Hspb11)
MBS1400738-04 0.1 mg (Yeast)

Recombinant Mouse Heat shock protein beta-11 (Hspb11)

Sign In for Pricing
View Details
Recombinant Mouse Heat shock protein beta-11 (Hspb11)
MBS1400738-05 0.02 mg (Baculovirus)

Recombinant Mouse Heat shock protein beta-11 (Hspb11)

Sign In for Pricing
View Details