Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Mouse (sf9, His)

S100A8 protein plays crucial roles in the immune system and inflammation.It activates NADPH-oxidase, generating reactive oxygen species in immune cells.Additionally, S100A8 facilitates the assembly of the NADPH-oxidase enzyme complex at the cell membrane and transfers the essential cofactor arachidonic acid to the complex.S100A8 Protein, Mouse (sf9, His) is the recombinant mouse-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Mouse (sf9, His), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-mouse-sf9-his.html

Purity

97.00

Smiles

MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Molecular Formula

20201 (Gene_ID) P27005 (M1-E89) (Accession)

Molecular Weight

Approximately 11.7 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Transmembrane protein 91 (TMEM91)
orb2930631-01 20 µg

Recombinant Human Transmembrane protein 91 (TMEM91)

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein 91 (TMEM91)
orb2930631-02 100 µg

Recombinant Human Transmembrane protein 91 (TMEM91)

Sign In for Pricing
View Details
Lentiviral mouse Zdhhc1 shRNA (UAS) - Lentiviral mouse Zdhhc1 shRNA (UAS) (100)
GTR15292698 1 Vial

Lentiviral mouse Zdhhc1 shRNA (UAS) - Lentiviral mouse Zdhhc1 shRNA (UAS) (100)

Sign In for Pricing
View Details
MRX71 CRISPR All-in-one AAV vector set (with saCas9)(Human)
30679151 3x 1.0 µg DNA

MRX71 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Necrostatin-34 (Nec-34)
E0301-5mg 5 mg

Necrostatin-34 (Nec-34)

Sign In for Pricing
View Details
NAT8 Antibody
61-730 400 µL

NAT8 Antibody

Sign In for Pricing
View Details