Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18, Mouse (solution)

IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (solution) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-18 Protein, Mouse (solution), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18-protein-mouse.html

Purity

98.00

Smiles

NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Molecular Formula

16173 (Gene_ID) P70380 (N36-S192) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Themis Antibody (719945) [DyLight 680]
FAB6816Y 0.1 mL

Rat Monoclonal Themis Antibody (719945) [DyLight 680]

Sign In for Pricing
View Details
Urea UV Auto, Urease/GLDH
D98707 5x 50 mL (250 mL)

Urea UV Auto, Urease/GLDH

Sign In for Pricing
View Details
Phospho-DNA PKcs (Thr2609) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3735R-BF488 100 µL

Phospho-DNA PKcs (Thr2609) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
HIF1AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV727565 1.0 µg DNA

HIF1AP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
VAMP4 discontinued
515695 100 µg

VAMP4 discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal PHLDB2 Antibody [Alexa Fluor 488]
NBP2-36546AF488 0.1 mL

Rabbit Polyclonal PHLDB2 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details