Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP1/L-FABP, Human (His)

FABP1/L-FABP Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

Product Specifications

Product Name Alternative

FABP1/L-FABP Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp1-protein-human-his.html

Purity

95.00

Smiles

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Molecular Formula

2168 (Gene_ID) P07148 (M1-I127) (Accession)

Molecular Weight

13-15 kDa

References & Citations

[1]S H Chen, et al. Human liver fatty acid binding protein gene is located on chromosome 2. Somat Cell Mol Genet. 1986 May;12 (3) :303-6|[2]I-Ting Tsai, et al. FABP1 and FABP2 as markers of diabetic nephropathy. Int J Med Sci. 2020 Aug 27;17 (15) :2338-2345.|[3]Huifeng Pi, et al. Long-term exercise prevents hepatic steatosis: a novel role of FABP1 in regulation of autophagy-lysosomal machinery. FASEB J. 2019 Nov;33 (11) :11870-11883.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMF1 Protein (N-His, Human)
P508831 100 µg

SUMF1 Protein (N-His, Human)

Sign In for Pricing
View Details
Dia 1 Lentiviral Activation Particles (m)
sc-420000-LAC 200 µL

Dia 1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Vil1 Rat shRNA Plasmid (Locus ID 316521)
TR706763 1 Kit

Vil1 Rat shRNA Plasmid (Locus ID 316521)

Sign In for Pricing
View Details
Mouse Endothelin B receptor, Ednrb ELISA KIT
ELI-06373m 96 Tests

Mouse Endothelin B receptor, Ednrb ELISA KIT

Sign In for Pricing
View Details
LOC685045 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27399156 3x 1.0 µg DNA

LOC685045 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
CYB5D1 Protein Vector (Human) (pPM-C-His)
PV071600 500 ng

CYB5D1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details