FABP1/L-FABP, Human (His)
FABP1/L-FABP Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.
Product Specifications
Product Name Alternative
FABP1/L-FABP Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fabp1-protein-human-his.html
Purity
95.00
Smiles
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Molecular Formula
2168 (Gene_ID) P07148 (M1-I127) (Accession)
Molecular Weight
13-15 kDa
References & Citations
[1]S H Chen, et al. Human liver fatty acid binding protein gene is located on chromosome 2. Somat Cell Mol Genet. 1986 May;12 (3) :303-6|[2]I-Ting Tsai, et al. FABP1 and FABP2 as markers of diabetic nephropathy. Int J Med Sci. 2020 Aug 27;17 (15) :2338-2345.|[3]Huifeng Pi, et al. Long-term exercise prevents hepatic steatosis: a novel role of FABP1 in regulation of autophagy-lysosomal machinery. FASEB J. 2019 Nov;33 (11) :11870-11883.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog