Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L3, Human (GST)

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (GST) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

DNASE1L3 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-gst.html

Purity

90.00

Smiles

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Molecular Formula

1776 (Gene_ID) Q13609 (M21-S305) (Accession)

Molecular Weight

Approximately 60.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vwc2l (NM_001109308) Rat Tagged ORF Clone Lentiviral Particle
RR215495L4V 200 µL

Vwc2l (NM_001109308) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 405)
MBS6282690-01 0.1 mL

CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 405)

Ask
View Details
CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 405)
MBS6282690-02 5x 0.1 mL

CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 405)

Ask
View Details
Recombinant Human N-acetylmuramoyl-L-alanine amidase Protein, His-SUMO, E.coli-1mg
QP7947-ec-1mg 1mg

Recombinant Human N-acetylmuramoyl-L-alanine amidase Protein, His-SUMO, E.coli-1mg

Ask
View Details
Goat anti Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains) (non Human and Mouse), conjugated with TRITC
MBS571383-01 1 mL

Goat anti Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains) (non Human and Mouse), conjugated with TRITC

Ask
View Details
Goat anti Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains) (non Human and Mouse), conjugated with TRITC
MBS571383-02 5x 1 mL

Goat anti Rat IgG1 IgG2a IgG2b IgG2c IgA IgM (heavy and light chains) (non Human and Mouse), conjugated with TRITC

Ask
View Details