DNASE1L3, Human (GST)
DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (GST) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
DNASE1L3 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-gst.html
Purity
90.00
Smiles
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Molecular Formula
1776 (Gene_ID) Q13609 (M21-S305) (Accession)
Molecular Weight
Approximately 60.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
303447 100 µg
MEK2, NT (Cardiofaciocutaneous Syndrome, CFC Syndrome, CFC4, Dual Specificity Mitogen Activated Protein Kinase Kinase 2, Dual Specificity Mitogen-activated Protein Kinase Kinase 2, ERK Activator Kinase 2, MAP Kinase Kinase 2, MAP2K 2, Map2k2, MAPK/ERK Kinase 2, MAPK/ERK Kinase 2, MAPKK 2, MAPKK2, MEK 2, MEK2, Microtubule Associated Protein Kinase Kinase 2, Mitogen Activated Protein Kinase Kinase 2, Mitogen Activated Protein Kinase Kinase 2 p45, MKK 2, MKK2, PRKMK 2, PRKMK2)
Ask
View Details 