Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L3, Human (GST)

DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (GST) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

DNASE1L3 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-gst.html

Purity

90.00

Smiles

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Molecular Formula

1776 (Gene_ID) Q13609 (M21-S305) (Accession)

Molecular Weight

Approximately 60.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TGIF2 (TGF-beta-induced Transcription Factor 2, TGFB-induced Factor 2, Homeobox Protein TGIF2, 5'-TG-3'-interacting Factor 2) (MaxLight 405) discontinued
134389-ML405 100 µL

TGIF2 (TGF-beta-induced Transcription Factor 2, TGFB-induced Factor 2, Homeobox Protein TGIF2, 5'-TG-3'-interacting Factor 2) (MaxLight 405) discontinued

Ask
View Details
ARFGEF2 Human shRNA Plasmid Kit (Locus ID 10564)
TL314697 1 Kit

ARFGEF2 Human shRNA Plasmid Kit (Locus ID 10564)

Ask
View Details
Chmp4b Rat Pre-designed siRNA Set A
HY-RS28353 1 Set

Chmp4b Rat Pre-designed siRNA Set A

Ask
View Details
C-raf 1 (Raf, Raf-1) (MaxLight 490) discontinued
C0039-01-ML490 100 µL

C-raf 1 (Raf, Raf-1) (MaxLight 490) discontinued

Ask
View Details
SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (PE)
MBS6394057-01 0.1 mL

SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (PE)

Ask
View Details
SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (PE)
MBS6394057-02 5x 0.1 mL

SGTA (Small Glutamine-rich Tetratricopeptide Repeat-containing Protein alpha, Alpha-SGT, Vpu-binding protein, UBP, SGT, SGT1) (PE)

Ask
View Details