DNASE1L3, Human (GST)
DNASE1L3 proteolytically cleaves single- and double-stranded DNA and generates fragments with 3'-OH termini. It can cleave chromatin, nucleosomes, and liposome-coated DNA. DNASE1L3 Protein, Human (GST) is the recombinant human-derived DNASE1L3 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
DNASE1L3 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dnase1l3-protein-human-gst.html
Purity
90.00
Smiles
MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Molecular Formula
1776 (Gene_ID) Q13609 (M21-S305) (Accession)
Molecular Weight
Approximately 60.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680050-100 1x 100 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942853-500 1x 500 µL
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details