Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial (Active)

Product Specifications

Product Name Alternative

Mast/stem cell growth factor receptor Kit; EC:2.7.10.1; SCFR; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD117; Kit; Sl

Abbreviation

Recombinant Mouse Kit protein, partial (Active)

Gene Name

Kit

UniProt

P05532-2

Expression Region

25-519aa

Organism

Mus musculus (Mouse)

Target Sequence

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHT

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg (CSB-MP012376MO1) at 2 μg/mL can bind Mouse Kit.The EC50 is 15.57-20.95 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

84.0 kDa

References & Citations

Nf1-/- Schwann cell-conditioned medium modulates mast cell degranulation by c-Kit-mediated hyperactivation of phosphatidylinositol 3-kinase. Chen S., Burgin S., McDaniel A., Li X., Yuan J., Chen M., Khalaf W., Clapp D.W., Yang F.C. Am. J. Pathol. 177:3125-3132 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EASYspin RNA Isolation Kit (For Fibrous Tissues) (without Phenol & Chloroform)
BPC1010 50 Tests

EASYspin RNA Isolation Kit (For Fibrous Tissues) (without Phenol & Chloroform)

Sign In for Pricing
View Details
Lentiviral human HIRA sgRNA gene knockout kit - Lentiviral human HIRA sgRNA gene knockout kit (25)
GTR15394347 1 Vial

Lentiviral human HIRA sgRNA gene knockout kit - Lentiviral human HIRA sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
AAZ-A 154 (benzoate)
HY-153015C Inquire

AAZ-A 154 (benzoate)

Sign In for Pricing
View Details
GPR17 Conjugated Antibody
MBS9455443-01 0.1 mL (Biotin)

GPR17 Conjugated Antibody

Sign In for Pricing
View Details
GPR17 Conjugated Antibody
MBS9455443-02 0.1 mL (AF350)

GPR17 Conjugated Antibody

Sign In for Pricing
View Details
GPR17 Conjugated Antibody
MBS9455443-03 0.1 mL (AF405)

GPR17 Conjugated Antibody

Sign In for Pricing
View Details