Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ribonuclease T2-A (Rnaset2a)

Product Specifications

Product Name Alternative

(Ribonuclease 6-A)

Abbreviation

Recombinant Mouse Rnaset2a protein

Gene Name

Rnaset2a

UniProt

C0HKG5

Expression Region

30-259aa

Organism

Mus musculus (Mouse)

Target Sequence

GPLWSGSHEWKKLILTQHWPPTVCKEVNSCQDSLDYWTIHGLWPDRAEDCNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSINYYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCTEPGEQLSSRQEAWLAMEASTHGMMVCEDGPIFYPPPTKTQH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8. Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8. Also plays a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria. Participates as well in degradation of mitochondrion-associated cytosolic rRNAs.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.2 kDa

References & Citations

"Interferon-driven brain phenotype in a mouse model of RNaseT2 deficient leukoencephalopathy." Kettwig M., Ternka K., Wendland K., Kruger D.M., Zampar S., Schob C., Franz J., Aich A., Winkler A., Sakib M.S., Kaurani L., Epple R., Werner H.B., Hakroush S., Kitz J., Prinz M., Bartok E., Hartmann G. Gartner J. Nat Commun 12:6530-6530 (2021)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Agrin ELISA Kit
MBS762489-01 48 Well

Human Agrin ELISA Kit

Sign In for Pricing
View Details
Human Agrin ELISA Kit
MBS762489-02 96 Well

Human Agrin ELISA Kit

Sign In for Pricing
View Details
Human Agrin ELISA Kit
MBS762489-03 5x 96 Well

Human Agrin ELISA Kit

Sign In for Pricing
View Details
Human Agrin ELISA Kit
MBS762489-04 10x 96 Well

Human Agrin ELISA Kit

Sign In for Pricing
View Details
Hmox2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4408707 1.0 µg DNA

Hmox2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal EphA6 Antibody (033) [Janelia Fluor 646]
NBP2-90658JF646 0.1 mL

Rabbit Monoclonal EphA6 Antibody (033) [Janelia Fluor 646]

Sign In for Pricing
View Details