Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCHP (NM_032300) Human 3' UTR Clone
SC214702 10 µg

TCHP (NM_032300) Human 3' UTR Clone

Sign In for Pricing
View Details
PCDHA12 Polyclonal Antibody
E-AB-63140-01 60 µL

PCDHA12 Polyclonal Antibody

Sign In for Pricing
View Details
PCDHA12 Polyclonal Antibody
E-AB-63140-02 120 µL

PCDHA12 Polyclonal Antibody

Sign In for Pricing
View Details
PCDHA12 Polyclonal Antibody
E-AB-63140-03 200 µL

PCDHA12 Polyclonal Antibody

Sign In for Pricing
View Details
Alk (ALK Tyrosine Kinase Receptor, Anaplastic lymphoma Kinase, CD246, Alk) (MaxLight 550) discontinued
302261-ML550 100 µL

Alk (ALK Tyrosine Kinase Receptor, Anaplastic lymphoma Kinase, CD246, Alk) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MYLK3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9865R-BF488 100 µL

MYLK3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details