DPEP1, Human (HEK293, His)
Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
DPEP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html
Purity
97.00
Smiles
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Molecular Formula
1800 (Gene_ID) P16444 (D17-S385) (Accession)
Molecular Weight
Approximately 41.0 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6008553-01 0.2 mL
CMKOR1, CT (CXCR7, CMKOR1, GPR159, RDC1, C-X-C chemokine receptor type 7, Chemokine orphan receptor 1, G-protein coupled receptor 159, G-protein coupled receptor RDC1 homolog)
Sign In for Pricing
View Details 
MBS6008553-02 5x 0.2 mL
CMKOR1, CT (CXCR7, CMKOR1, GPR159, RDC1, C-X-C chemokine receptor type 7, Chemokine orphan receptor 1, G-protein coupled receptor 159, G-protein coupled receptor RDC1 homolog)
Sign In for Pricing
View Details 
RDR-TNFRSF1B-Hu-01 96 Tests
Human Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) ELISA Kit
Sign In for Pricing
View Details RDR-TNFRSF1B-Hu-02 48 Tests
Human Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) ELISA Kit
Sign In for Pricing
View Details 
MBS1457370-01 0.02 mg (E-Coli)
Recombinant Nitrobacter winogradskyi Chorismate synthase (aroC)
Sign In for Pricing
View Details MBS1457370-02 0.02 mg (Yeast)
Recombinant Nitrobacter winogradskyi Chorismate synthase (aroC)
Sign In for Pricing
View Details