Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTR/Prealbumin Polyclonal Antibody, APC Conjugated
bs-41140R-APC 100 µL

TTR/Prealbumin Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Nori® Equine 2-Plex ELISA Kits-BMP1/RANKL
GR225179 96 Well

Nori® Equine 2-Plex ELISA Kits-BMP1/RANKL

Sign In for Pricing
View Details
RAB15 rabbit pAb
ES10112-01 50 µL

RAB15 rabbit pAb

Sign In for Pricing
View Details
RAB15 rabbit pAb
ES10112-02 100 µL

RAB15 rabbit pAb

Sign In for Pricing
View Details
SOX6 (NM_033326) Human Over-expression Lysate
LS055553-100ug 100 µg

SOX6 (NM_033326) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal Histone H3 [ac Lys27] Antibody (172)
NBP2-61549 100 µg

Rabbit Monoclonal Histone H3 [ac Lys27] Antibody (172)

Sign In for Pricing
View Details