Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpc (NM_001004098) Rat Tagged Lenti ORF Clone
RR207726L4 10 µg

Cenpc (NM_001004098) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human ADAM8 Protein (aa 82-192) [His] [T7]
VAng-2874Lsx-500g 500 µg

Recombinant Human ADAM8 Protein (aa 82-192) [His] [T7]

Sign In for Pricing
View Details
NHEJ1 Knockout HT29 Polyclonal Cells
ARG13933 1 Million

NHEJ1 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
RNF40 Protein Lysate
OCOA02151-20UG 20 µg

RNF40 Protein Lysate

Sign In for Pricing
View Details
Ubie3 (m) -PR
sc-154862-PR 10 µM - 20 µL

Ubie3 (m) -PR

Sign In for Pricing
View Details
NOD2 agonist 3
HY-168158 1 Each

NOD2 agonist 3

Sign In for Pricing
View Details