Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV6-CSF1R-FLAG-Neo Plasmid
PVT67616 2 µg

PCMV6-CSF1R-FLAG-Neo Plasmid

Sign In for Pricing
View Details
Znhit1 3'UTR Lenti-reporter-Luc Vector
51927084 1.0 µg

Znhit1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RGD1303271 Protein Lysate (Rat) with C-HA Tag
38901036 100 µg

RGD1303271 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)
MBS2097736-01 0.01 mg

Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)

Sign In for Pricing
View Details
Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)
MBS2097736-02 0.05 mg

Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)

Sign In for Pricing
View Details
Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)
MBS2097736-03 0.1 mg

Synthetic Cross Linked C-Telopeptide Of Type II Collagen (CTXII)

Sign In for Pricing
View Details