Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD3E protein, C-mFc Tag
IMP-517 10 µg

Recombinant Human CD3E protein, C-mFc Tag

Sign In for Pricing
View Details
Chorionic Gonadotropin Alpha (HCG Alpha)
470882 1 mg

Chorionic Gonadotropin Alpha (HCG Alpha)

Sign In for Pricing
View Details
Mroh2a (NM_001281466) Mouse Tagged ORF Clone
MR231858 10 µg

Mroh2a (NM_001281466) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Benzyl 3-O-allyl-2-O-benzyl-β-D-glucopyranoside
GC4481-1g 1 g

Benzyl 3-O-allyl-2-O-benzyl-β-D-glucopyranoside

Sign In for Pricing
View Details
Uprt Mouse qPCR Primer Pair (NM_001081189)
MP218097 200 Reactions

Uprt Mouse qPCR Primer Pair (NM_001081189)

Sign In for Pricing
View Details
LPCAT1 (NM_024830) Human Over-expression Lysate
LS079888-20ug 20 µg

LPCAT1 (NM_024830) Human Over-expression Lysate

Sign In for Pricing
View Details