Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Snapc3 activation kit by CRISPRa
GA210793 1 Kit

Mouse Snapc3 activation kit by CRISPRa

Sign In for Pricing
View Details
DGKH (NM_001297429) Human Tagged ORF Clone
RG239785 10 µg

DGKH (NM_001297429) Human Tagged ORF Clone

Sign In for Pricing
View Details
Zfp703 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
51092156 3x 1.0 µg DNA

Zfp703 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
ZNF345, NT (Zinc finger protein 345,ZNF345,)
MBS6002794-01 0.2 mL

ZNF345, NT (Zinc finger protein 345,ZNF345,)

Sign In for Pricing
View Details
ZNF345, NT (Zinc finger protein 345,ZNF345,)
MBS6002794-02 5x 0.2 mL

ZNF345, NT (Zinc finger protein 345,ZNF345,)

Sign In for Pricing
View Details
TAG-72 (CA 72.4, Tumor associated glycoprotein 72) (BSA & Azide Free) (MaxLight 405) discontinued
168863-AF-ML405 100 µL

TAG-72 (CA 72.4, Tumor associated glycoprotein 72) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details