Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Rotavirus antigen, RV Ag ELISA Kit
MBS703054-01 24 Well (LIMIT 1)

Human Rotavirus antigen, RV Ag ELISA Kit

Sign In for Pricing
View Details
Human Rotavirus antigen, RV Ag ELISA Kit
MBS703054-02 48 Well

Human Rotavirus antigen, RV Ag ELISA Kit

Sign In for Pricing
View Details
Human Rotavirus antigen, RV Ag ELISA Kit
MBS703054-03 96 Well

Human Rotavirus antigen, RV Ag ELISA Kit

Sign In for Pricing
View Details
Human Rotavirus antigen, RV Ag ELISA Kit
MBS703054-04 5x 96 Well

Human Rotavirus antigen, RV Ag ELISA Kit

Sign In for Pricing
View Details
Human Rotavirus antigen, RV Ag ELISA Kit
MBS703054-05 10x 96 Well

Human Rotavirus antigen, RV Ag ELISA Kit

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae ileS Protein (aa 1-929) (strain NCCP11945)
VAng-Wyb2167-1mgEcoli 1 mg (E. coli)

Recombinant Neisseria Gonorrhoeae ileS Protein (aa 1-929) (strain NCCP11945)

Sign In for Pricing
View Details