Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aminoacylase-1 / ACY1 (1-408, His-tag) Mouse Protein
AR51951PU-S 20 µg

Aminoacylase-1 / ACY1 (1-408, His-tag) Mouse Protein

Sign In for Pricing
View Details
PPP3R2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37492151 3x 1.0 µg DNA

PPP3R2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (MaxLight 750)
MBS6235157-01 0.1 mL

S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (MaxLight 750)

Sign In for Pricing
View Details
S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (MaxLight 750)
MBS6235157-02 5x 0.1 mL

S100P (S100 Calcium-binding Protein P, Protein S100-P, Migration-inducing Gene 9 Protein, MIG9, Protein S100-E, S100E) (MaxLight 750)

Sign In for Pricing
View Details
SH2D5 Protein Vector (Mouse) (pPM-C-His)
PV228797 500 ng

SH2D5 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Psg29 shRNA (UAS) - Lentiviral mouse Psg29 shRNA (UAS, iRFP) (100)
GTR15143391 1 Vial

Lentiviral mouse Psg29 shRNA (UAS) - Lentiviral mouse Psg29 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details