DPEP1, Human (HEK293, His)
Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
DPEP1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html
Purity
97.00
Smiles
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
Molecular Formula
1800 (Gene_ID) P16444 (D17-S385) (Accession)
Molecular Weight
Approximately 41.0 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940750-100 1x 100 µL
CD8 (C8/468 + C8/144B), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741858-100 1x 100 µL
CD43 (T-Cell Marker) (rSPN/1094), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682295-100 1x 100 µL
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details