Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPEP1, Human (HEK293, His)

Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DPEP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dpep1-protein-human-hek-293-his.html

Purity

97.00

Smiles

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

Molecular Formula

1800 (Gene_ID) P16444 (D17-S385) (Accession)

Molecular Weight

Approximately 41.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Complement Factor D/Adipsin Antibody (104) [mFluor Violet 500 SE]
NBP2-90629MFV500 0.1 mL

Rabbit Monoclonal Complement Factor D/Adipsin Antibody (104) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Human PSA Matched Antibody Pair Set [Z01LS-0722-LS200]
Z01LS-0722-LS200 5 Plates

Human PSA Matched Antibody Pair Set [Z01LS-0722-LS200]

Sign In for Pricing
View Details
TRIM5 alpha (TRIM5) (NM_033093) Human Over-expression Lysate
LC409743 20 µg

TRIM5 alpha (TRIM5) (NM_033093) Human Over-expression Lysate

Sign In for Pricing
View Details
Olr367 Protein Vector (Rat) (pPM-C-HA)
PV289804 500 ng

Olr367 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
AFG3L2 Polyclonal Antibody
MBS8595423-01 0.1 mg

AFG3L2 Polyclonal Antibody

Sign In for Pricing
View Details
AFG3L2 Polyclonal Antibody
MBS8595423-02 0.1 mL (AF405L)

AFG3L2 Polyclonal Antibody

Sign In for Pricing
View Details