Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM1, Rat (HEK293, His)

CEACAM1 protein is involved in the regulation of hepatic lipogenesis and inhibition of cell proliferation. It interacts with INSR to reduce fatty acid synthesis and with SHC1 to inhibit cell proliferation. CEACAM1 Protein, Rat (HEK293, His) is the recombinant rat-derived CEACAM1 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

CEACAM1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ceacam1-protein-rat-hek293-his.html

Purity

95.0

Smiles

QVTVDAVPPNVVEEKSVLLLAHNLPQEFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAYTLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSRNGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAPVISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACFVNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQSLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSGLS

Molecular Formula

81613 (Gene_ID) P16573-1 (Q35-S422) (Accession)

Molecular Weight

66-76 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL17A Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2140R-BF594-01 20 µL

IL17A Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
IL17A Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-2140R-BF594-02 100 µL

IL17A Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CYP17A1 (Cytochrome P450 17A1, CPT7, CYP17, P450C17, S17AH, CYP17A1) (MaxLight 750)
MBS6413404-01 0.1 mL

CYP17A1 (Cytochrome P450 17A1, CPT7, CYP17, P450C17, S17AH, CYP17A1) (MaxLight 750)

Sign In for Pricing
View Details
CYP17A1 (Cytochrome P450 17A1, CPT7, CYP17, P450C17, S17AH, CYP17A1) (MaxLight 750)
MBS6413404-02 5x 0.1 mL

CYP17A1 (Cytochrome P450 17A1, CPT7, CYP17, P450C17, S17AH, CYP17A1) (MaxLight 750)

Sign In for Pricing
View Details
MMP9 Recombinant Rabbit Monoclonal Antibody (Cy7)
orb2350053 100 µL

MMP9 Recombinant Rabbit Monoclonal Antibody (Cy7)

Sign In for Pricing
View Details
NeuN Polyclonal Antibody, APC-Cy7 Conjugated
bs-1613R-APC-Cy7 100 µL

NeuN Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details