Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-26, Human

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MMP-26 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-26-protein-human.html

Purity

96.0

Smiles

TSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Molecular Formula

56547 (Gene_ID) Q9NRE1 (T90-P261) (Accession)

Molecular Weight

Approximately 19 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)
MBS6332483-01 0.1 mL

PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)

Ask
View Details
PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)
MBS6332483-02 5x 0.1 mL

PDLIM1, CT (PDLIM1, CLIM1, CLP36, PDZ and LIM domain protein 1, C-terminal LIM domain protein 1, Elfin, LIM domain protein CLP-36) (MaxLight 750)

Ask
View Details
KCNK10 Blocking Peptide
33R-7555 100 ug

KCNK10 Blocking Peptide

Ask
View Details
Rabbit Polyclonal Max Antibody [Alexa Fluor 594]
NBP3-00047AF594 0.1 mL

Rabbit Polyclonal Max Antibody [Alexa Fluor 594]

Ask
View Details
Rabbit Polyclonal Olfactory receptor 470 Antibody
NBP3-10256-100ul 100 µL

Rabbit Polyclonal Olfactory receptor 470 Antibody

Ask
View Details