Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-26, Human

The MMP-26 protein has broad substrate specificity and hydrolyzes type IV collagen, fibronectin, fibrinogen, β-casein, type I gelatin, and α-1 protease inhibitors. The versatility of this enzyme suggests involvement in the degradation and remodeling of various extracellular matrix components. MMP-26 Protein, Human is the recombinant human-derived MMP-26 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

MMP-26 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-26-protein-human.html

Purity

96.0

Smiles

TSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP

Molecular Formula

56547 (Gene_ID) Q9NRE1 (T90-P261) (Accession)

Molecular Weight

Approximately 19 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NOLA1 (GAR1) (NM_018983) Human Recombinant Protein
TP301481 20 µg

NOLA1 (GAR1) (NM_018983) Human Recombinant Protein

Ask
View Details
Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7224992-01 48 Well

Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Ask
View Details
Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7224992-02 96 Well

Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Ask
View Details
Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7224992-03 5x 96 Well

Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Ask
View Details
Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit
MBS7224992-04 10x 96 Well

Guinea pig ATP-binding cassette sub-family G member 8 (ABCG8) ELISA Kit

Ask
View Details
Recombinant Escherichia coli Putative aminoacrylate peracid reductase RutC (rutC)
MBS1257788-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Putative aminoacrylate peracid reductase RutC (rutC)

Ask
View Details