Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDH16A1 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to ALDH16A1

Product Specifications

UniProt

Q8IZ83

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDH16A1

Target

ALDH16A1

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: YGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENL

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

33kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (MaxLight 405)
MBS6370732-01 0.1 mL

ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (MaxLight 405)

Sign In for Pricing
View Details
ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (MaxLight 405)
MBS6370732-02 5x 0.1 mL

ATP6V0B (V-type Proton ATPase 21kD Proteolipid Subunit, V-ATPase 21kD Proteolipid Subunit, Vacuolar Proton Pump 21kD Proteolipid Subunit, hATPL, ATP6F) (MaxLight 405)

Sign In for Pricing
View Details
VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 650) discontinued
031332-ML650 100 µL

VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
OPA1 (Dynamin-like 120kD Protein, Mitochondrial, Optic Atrophy Protein 1, KIAA0567) (MaxLight 750) discontinued
029570-ML750 100 µL

OPA1 (Dynamin-like 120kD Protein, Mitochondrial, Optic Atrophy Protein 1, KIAA0567) (MaxLight 750) discontinued

Sign In for Pricing
View Details
POU6F1, NT (POU6F1, BRN5, MPOU, TCFB1, POU domain, class 6, transcription factor 1, Brain-specific homeobox/POU domain protein 5, mPOU homeobox protein) (MaxLight 750)
MBS6336058-01 0.1 mL

POU6F1, NT (POU6F1, BRN5, MPOU, TCFB1, POU domain, class 6, transcription factor 1, Brain-specific homeobox/POU domain protein 5, mPOU homeobox protein) (MaxLight 750)

Sign In for Pricing
View Details
POU6F1, NT (POU6F1, BRN5, MPOU, TCFB1, POU domain, class 6, transcription factor 1, Brain-specific homeobox/POU domain protein 5, mPOU homeobox protein) (MaxLight 750)
MBS6336058-02 5x 0.1 mL

POU6F1, NT (POU6F1, BRN5, MPOU, TCFB1, POU domain, class 6, transcription factor 1, Brain-specific homeobox/POU domain protein 5, mPOU homeobox protein) (MaxLight 750)

Sign In for Pricing
View Details