Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276/B7-H3, Cynomolgus (HEK293, His)

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD276/B7-H3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD276/B7-H3 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd276-b7-h3-protein-cynomolgus-hek-293-his.html

Purity

98.0

Smiles

LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPE

Molecular Formula

102131295 (Gene_ID) XP_015308534.1 (L29-E465) (Accession)

Molecular Weight

Approximately 70-95 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL3ST4 Antibody (Center)
E45M04674G-4 50 µL

GAL3ST4 Antibody (Center)

Sign In for Pricing
View Details
Amyloid Precursor Protein Rabbit mAb
F2535-100uL*2 2x 100 μL

Amyloid Precursor Protein Rabbit mAb

Sign In for Pricing
View Details
Chk2 Mouse Monoclonal Antibody
BF8183-01 100 µL

Chk2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Chk2 Mouse Monoclonal Antibody
BF8183-02 200 µL

Chk2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PP2A-Cβ CRISPR/Cas9 KO Plasmid (m2)
sc-422382-KO-2 20 µg

PP2A-Cβ CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Mouse CD22 Polyclonal Antibody
E55A03916 100 µg

Mouse CD22 Polyclonal Antibody

Sign In for Pricing
View Details