Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnase 3, Human (HEK293, His)

Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Rnase 3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rnase-3-protein-human-hek-293-his.html

Purity

98.0

Smiles

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Molecular Formula

6037 (Gene_ID) AAH96060.1 (R28-I160) (Accession)

Molecular Weight

25-35 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-500 1x 500 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details