Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2/HEK293 Stable Cell Line

TLR2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human Toll-like receptor 2 (TLR2, also designated as CD282) . TLR2 mediates immune responses by recognition of lipid-containing pathogen-associated molecular patterns (PAMPs) such as lipoteichoic acid and di- and tri-acylated cysteine-containing lipoproteins. TLR2 forms heterodimers with TLR1 or TLR6 as the initial step in a signal transduction cascade which leads to significant innate immune responses as well as development of adaptive immunity. TLR2-TLR1 heterodimers recognize triacylated lipopeptides from Gram-negative bacteria and mycoplasma, while TLR2-TLR6 heterodimers recognize diacylated lipopeptides from Gram-positive bacteria and mycoplasma. Note that TLR2 in the TLR2/HEK293 stable cell line contains the N-terminal HA tag (Figure 2), which does not interfere with TLR2 activity as confirmed by functional assay (Figure 1) . Sequence data: Human TLR2 (accession number NP_001305716) MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLN SIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSL EHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMD TFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFV DVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQI SGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSL TERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTL ILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISR NAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDS PSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAW LQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPG KWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPI EKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

Product Specifications

Applications

Functional Assay

Components

Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO

Shipping Conditions

Dry Ice

Storage Conditions

Immediately upon receipt, store in liquid nitrogen.

Applications Notes

Application:. Functional assay. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 μg/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. LIMITED USE RESTRICTIONS: THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE. By use of this product, user agrees to be bound by the terms of this limited use statement. This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party. Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com) .
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RMND1 Antibody, Biotin conjugated
MBS7051363-01 0.05 mg

RMND1 Antibody, Biotin conjugated

Ask
View Details
RMND1 Antibody, Biotin conjugated
MBS7051363-02 0.1 mg

RMND1 Antibody, Biotin conjugated

Ask
View Details
RMND1 Antibody, Biotin conjugated
MBS7051363-03 5x 0.1 mg

RMND1 Antibody, Biotin conjugated

Ask
View Details
MYH14 discontinued
539327-01 30ul

MYH14 discontinued

Ask
View Details
MYH14 discontinued
539327-02 100 µL

MYH14 discontinued

Ask
View Details
Ammonium Metavanadate extrapure, 98%
23185-01 100 g

Ammonium Metavanadate extrapure, 98%

Ask
View Details