Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Claudin18.2/HEK293 Stable Cell Line

Claudin 18.2/HEK293 Stable Cell Line is a stably transfected HEK293 cell line which expresses human claudin 18.2 (CLDN18.2) . CLDN18.2 is a highly selective marker protein that is exclusively expressed in differentiated gastric mucosal membrane epithelial cells. Abnormal expression of CLDN18.2 has been observed during the occurence and development of various primary malignat tumors such as gastric cancer, breast cancer, colon cancer and liver cancer. CLDN18.2 has become a significant biomarker for targeted therapy in different cancers, and a monoclonal antibody against CLDN18.2 such as Anti-CLDN18.2 (zolbetuximab biosimilar, Abeomics, Cat. No.: 12-9134) is an example utilized in the immunotherapy targeting CLDN18.2. Sequence data: Human CLDN18.2 (accession number NP_001002026) MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAM LQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTA NMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGG FKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV

Product Specifications

Applications

Functional Assay

Components

Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO

Shipping Conditions

Dry Ice

Storage Conditions

Immediately upon receipt, store in liquid nitrogen.

Applications Notes

Application:. Screen for antibodies of human Claudin 18.2 through Flow Cytometry. Culture conditions: Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 μg/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. LIMITED USE RESTRICTIONS: THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE. By use of this product, user agrees to be bound by the terms of this limited use statement. This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party. Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com) .
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Donkey Platelet Derived Growth Factor Receptor (PDGFR) ELISA Kit
MBS9348045 Inquire

Donkey Platelet Derived Growth Factor Receptor (PDGFR) ELISA Kit

Ask
View Details
Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924709-01 48 Well

Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Ask
View Details
Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924709-02 96 Well

Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Ask
View Details
Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924709-03 5x 96 Well

Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Ask
View Details
Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924709-04 10x 96 Well

Sheep Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Ask
View Details
ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody (PE)
abx448400 200 µg

ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody (PE)

Ask
View Details