Claudin18.2/CHO-K1 Stable Cell Line
Claudin 18.2/CHO-K1 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human claudin 18.2 (CLDN18.2) . CLDN18.2 is a highly selective marker protein that is exclusively expressed in differentiated gastric mucosal membrane epithelial cells. Abnormal expression of CLDN18.2 has been observed during the occurence and development of various primary malignat tumors such as gastric cancer, breast cancer, colon cancer and liver cancer. CLDN18.2 has become a significant biomarker for targeted therapy in different cancers, and a monoclonal antibody against CLDN18.2 such as Anti-CLDN18.2 (zolbetuximab biosimilar, Abeomics, Cat. No.: 12-9134) is an example utilized in the immunotherapy targeting CLDN18.2. Sequence data: Human CLDN18.2 (accession number NP_001002026) MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAM LQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTA NMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGG FKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Product Specifications
Applications
Functional Assay
Components
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Shipping Conditions
Dry Ice
Storage Conditions
Immediately upon receipt, store in liquid nitrogen.
Applications Notes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items